Comparing 353285 FitnessBrowser__Btheta:353285 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 11 hits to proteins with known functional sites (download)
O50146 [LysW]-L-2-aminoadipate 6-phosphate reductase; EC 1.2.1.103 from Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27) (see paper)
30% identity, 96% coverage: 6:315/322 of query aligns to 8:337/344 of O50146
2ozpA Crystal structure of n-acetyl-gamma-glutamyl-phosphate reductase (ttha1904) from thermus thermophilus
29% identity, 96% coverage: 6:315/322 of query aligns to 6:335/342 of 2ozpA
5einA Crystal structure of c148a mutant of lysy from thermus thermophilus in complex with NADP+ and lysw-gamma-aminoadipic acid (see paper)
30% identity, 96% coverage: 6:315/322 of query aligns to 8:337/344 of 5einA
2i3gA Crystal structure of n-acetyl-gamma-glutamyl-phosphate reductase (rv1652) from mycobacterium tuberculosis in complex with NADP+. (see paper)
29% identity, 98% coverage: 3:317/322 of query aligns to 6:342/347 of 2i3gA
7npjB Crystal structure of mycobacterium tuberculosis argc in complex with 6-phenoxy-3-pyridinamine
29% identity, 98% coverage: 3:317/322 of query aligns to 3:339/344 of 7npjB
7nphC Crystal structure of mycobacterium tuberculosis argc in complex with 5-methoxy-1,3-benzoxazole-2-carboxylic acid
29% identity, 98% coverage: 3:317/322 of query aligns to 3:339/344 of 7nphC
7notA Crystal structure of mycobacterium tuberculosis argc in complex with nicotinamide adenine dinucleotide phosphate (NADP+) and 5-methoxy-3- indoleacetic acid
29% identity, 98% coverage: 3:317/322 of query aligns to 3:339/344 of 7notA
7nnrA Crystal structure of mycobacterium tuberculosis argc in complex with xanthene-9-carboxylic acid
29% identity, 98% coverage: 3:317/322 of query aligns to 3:339/344 of 7nnrA
4dpmA Structure of malonyl-coenzyme a reductase from crenarchaeota in complex with coa (see paper)
23% identity, 64% coverage: 2:208/322 of query aligns to 3:221/354 of 4dpmA
Sites not aligning to the query:
4dplA Structure of malonyl-coenzyme a reductase from crenarchaeota in complex with NADP (see paper)
23% identity, 64% coverage: 2:208/322 of query aligns to 3:221/354 of 4dplA
Sites not aligning to the query:
4dpkA Structure of malonyl-coenzyme a reductase from crenarchaeota (see paper)
23% identity, 64% coverage: 2:208/322 of query aligns to 3:221/354 of 4dpkA
Sites not aligning to the query:
>353285 FitnessBrowser__Btheta:353285
MIKAGIIGGAGYTAGELIRLLLNHPETEIVFINSSSNAGNRITDVHEGLYGETDLRFTDQ
LPLDAIDVLFFCTAHGDTKKFMESHNVPEDLKIIDLSMDYRIKSDDHDFIYGLPELNRRA
TCTAKHVANPGCFATCIQLGLLPLAKNLMLTGDVSVNAITGSTGAGVKPGATSHFSWRNN
NISIYKAFDHQHVPEIKQSLKQLQNSFDSEIDFIPYRGDFPRGIFATLVVKTKVALEEIV
RMYEEYYAKDSFVHIVDKNIDLKQVVNTNKCLIHLEKHGDKLLIISCIDNLLKGASGQAV
HNMNLMFNLEETVGLRLKPSAF
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory