Comparing 353289 FitnessBrowser__Btheta:353289 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P32171 L-Rhamnulokinase; RhaB; RhuK; ATP:L-rhamnulose phosphotransferase; L-rhamnulose 1-kinase; Rhamnulose kinase; EC 2.7.1.5 from Escherichia coli (strain K12) (see paper)
44% identity, 96% coverage: 3:467/485 of query aligns to 4:465/489 of P32171
2uytA Structure of l-rhamnulose kinase in complex with adp and beta-l- rhamnulose. (see paper)
44% identity, 96% coverage: 3:467/485 of query aligns to 3:464/479 of 2uytA
2cglA Crystal structure of l-rhamnulose kinase from escherichia coli in complex with l-fructose, adp and a modeled atp gamma phosphate. (see paper)
44% identity, 96% coverage: 3:467/485 of query aligns to 3:464/479 of 2cglA
2cgjA Crystal structure of l-rhamnulose kinase from escherichia coli in complex with l-fructose and adp. (see paper)
44% identity, 96% coverage: 3:467/485 of query aligns to 3:464/479 of 2cgjA
Q1R415 Rhamnulokinase; Rhamnulose kinase; EC 2.7.1.5 from Escherichia coli (strain UTI89 / UPEC) (see paper)
44% identity, 96% coverage: 3:467/485 of query aligns to 4:465/489 of Q1R415
6k76A Glycerol kinase form thermococcus kodakarensis, complex structure with substrate.
26% identity, 93% coverage: 6:455/485 of query aligns to 2:447/485 of 6k76A
P18157 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Bacillus subtilis (strain 168) (see paper)
23% identity, 95% coverage: 1:461/485 of query aligns to 1:471/496 of P18157
3ll3B The crystal structure of ligand bound xylulose kinase from lactobacillus acidophilus
23% identity, 42% coverage: 70:274/485 of query aligns to 68:272/490 of 3ll3B
Sites not aligning to the query:
3ll3A The crystal structure of ligand bound xylulose kinase from lactobacillus acidophilus
23% identity, 42% coverage: 70:274/485 of query aligns to 69:273/492 of 3ll3A
Sites not aligning to the query:
O34153 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Enterococcus casseliflavus (Enterococcus flavescens) (see 3 papers)
22% identity, 94% coverage: 2:455/485 of query aligns to 4:464/506 of O34153
3h3nX Glycerol kinase h232r with glycerol (see paper)
22% identity, 94% coverage: 2:455/485 of query aligns to 3:463/501 of 3h3nX
5ya1A Crystal structure of lsrk-hpr complex with atp (see paper)
23% identity, 72% coverage: 118:468/485 of query aligns to 115:467/478 of 5ya1A
5ya2A Crystal structure of lsrk-hpr complex with adp (see paper)
23% identity, 72% coverage: 118:468/485 of query aligns to 115:467/478 of 5ya2A
3ge1A 2.7 angstrom crystal structure of glycerol kinase (glpk) from staphylococcus aureus in complex with adp and glycerol
22% identity, 92% coverage: 1:444/485 of query aligns to 2:452/499 of 3ge1A
Q5HGD2 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Staphylococcus aureus (strain COL)
22% identity, 92% coverage: 1:444/485 of query aligns to 1:451/498 of Q5HGD2
1gllO Escherichia coli glycerol kinase mutant with bound atp analog showing substantial domain motion (see paper)
25% identity, 58% coverage: 164:444/485 of query aligns to 172:447/494 of 1gllO
Sites not aligning to the query:
1gljO Escherichia coli glycerol kinase mutant with bound atp analog showing substantial domain motion (see paper)
25% identity, 58% coverage: 164:444/485 of query aligns to 172:447/494 of 1gljO
Sites not aligning to the query:
1bwfO Escherichia coli glycerol kinase mutant with bound atp analog showing substantial domain motion (see paper)
25% identity, 58% coverage: 164:444/485 of query aligns to 172:447/494 of 1bwfO
Sites not aligning to the query:
1bu6Y Crystal structures of escherichia coli glycerol kinase and the mutant a65t in an inactive tetramer: conformational changes and implications for allosteric regulation (see paper)
25% identity, 58% coverage: 164:444/485 of query aligns to 172:451/499 of 1bu6Y
Sites not aligning to the query:
1glfO Crystal structures of escherichia coli glycerol kinase and the mutant a65t in an inactive tetramer: conformational changes and implications for allosteric regulation (see paper)
25% identity, 58% coverage: 164:444/485 of query aligns to 172:451/498 of 1glfO
Sites not aligning to the query:
>353289 FitnessBrowser__Btheta:353289
MKQNFFAVDLGATSGRTILGSFIEGGLNLEEINRFPNHLIEVGGHFYWDIYALYRHIIDG
LKLVAHRGESIASIGIDTWGVDFVLLGKDGNLLRQPYAYRDPHTVGAPEAFFSRISRSEV
YGKTGIQVMNFNSLFQLDTLRRNHDSALEAADKVLFMPDALSYMLTGKMVTEYTIASTAQ
LVNAHTQRLEPELLKAVGLQEENFGRFVFPGEKIGTLTEEVQKITGLGAIPVIAVAGHDT
GSAVAAVPALDRNFAYLSSGTWSLMGVETDAPVITAETEALNFTNEGGVEGTIRLLKNIC
GMWLLERCRLNWGDTSYPELITEADSCEPFRSLINPDDDCFANPADMEQAIREYCRTTGQ
PVPEQRGQIVRCIFESLALRYRQVLENLRALSPRPIETLHVIGGGSRNDLLNQFTANAIG
IPVVAGPSEATAIGNVMIQAMTVGEATDVAGMRQLISRSIPLKTYHPQDMAAWDAAYIHF
KNCVR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory