Comparing 353363 BT3837 ABC transporter ATP-binding protein (NCBI ptt file) to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6mjpA Lptb(e163q)fgc from vibrio cholerae (see paper)
54% identity, 93% coverage: 7:244/255 of query aligns to 2:240/240 of 6mjpA
6s8nB Cryo-em structure of lptb2fgc in complex with lipopolysaccharide (see paper)
51% identity, 92% coverage: 8:242/255 of query aligns to 3:238/238 of 6s8nB
6s8gA Cryo-em structure of lptb2fgc in complex with amp-pnp (see paper)
51% identity, 92% coverage: 8:242/255 of query aligns to 3:238/238 of 6s8gA
6mbnA Lptb e163q in complex with atp (see paper)
51% identity, 93% coverage: 8:244/255 of query aligns to 4:241/241 of 6mbnA
6b89A E. Coli lptb in complex with adp and novobiocin (see paper)
52% identity, 91% coverage: 8:238/255 of query aligns to 3:234/234 of 6b89A
4p31A Crystal structure of a selenomethionine derivative of e. Coli lptb in complex with adp-magensium (see paper)
52% identity, 91% coverage: 8:238/255 of query aligns to 3:234/234 of 4p31A
6mhzA Vanadate trapped cryo-em structure of e.Coli lptb2fg transporter (see paper)
52% identity, 91% coverage: 8:238/255 of query aligns to 3:234/235 of 6mhzA
6b8bA E. Coli lptb in complex with adp and a novobiocin derivative (see paper)
52% identity, 90% coverage: 8:237/255 of query aligns to 3:233/233 of 6b8bA
7d0aB Acinetobacter mlafedb complex in adp-vanadate trapped vclose conformation (see paper)
33% identity, 88% coverage: 4:227/255 of query aligns to 1:228/263 of 7d0aB
7d08B Acinetobacter mlafedb complex in atp-bound vtrans1 conformation (see paper)
33% identity, 88% coverage: 4:227/255 of query aligns to 1:228/263 of 7d08B
6z5uK Cryo-em structure of the a. Baumannii mlabdef complex bound to appnhp (see paper)
34% identity, 87% coverage: 7:227/255 of query aligns to 2:226/253 of 6z5uK
1ji0A Crystal structure analysis of the abc transporter from thermotoga maritima
32% identity, 93% coverage: 4:239/255 of query aligns to 3:238/240 of 1ji0A
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
32% identity, 88% coverage: 7:230/255 of query aligns to 4:240/254 of 1g6hA
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
32% identity, 88% coverage: 7:230/255 of query aligns to 4:240/253 of 1g9xB
4yerA Crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution
34% identity, 87% coverage: 7:227/255 of query aligns to 4:223/285 of 4yerA
7chaI Cryo-em structure of p.Aeruginosa mlafebd with amppnp (see paper)
29% identity, 85% coverage: 13:230/255 of query aligns to 9:230/262 of 7chaI
1vciA Crystal structure of the atp-binding cassette of multisugar transporter from pyrococcus horikoshii ot3 complexed with atp (see paper)
32% identity, 87% coverage: 5:227/255 of query aligns to 3:216/353 of 1vciA
Q9AT00 Protein TRIGALACTOSYLDIACYLGLYCEROL 3, chloroplastic; ABC transporter I family member 13; ABC transporter ABCI.13; AtABCI13; Non-intrinsic ABC protein 11; AtNAP11 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
29% identity, 91% coverage: 3:235/255 of query aligns to 80:333/345 of Q9AT00
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
30% identity, 93% coverage: 15:250/255 of query aligns to 25:265/378 of P69874
Sites not aligning to the query:
1oxvD Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
28% identity, 89% coverage: 5:232/255 of query aligns to 3:233/353 of 1oxvD
>353363 BT3837 ABC transporter ATP-binding protein (NCBI ptt file)
MEESKMVLRTEDLVKKYGKRTVVSHVSIDVKQGEIVGLLGPNGAGKTTSFYMTVGLITPN
EGRIFLDDLEITKFPVYKRAQTGIGYLAQEASVFRQMSVEDNIASVLEMTNKPKDYQKDK
LESLIAEFRLQKVRKNKGNQLSGGERRRTEIARCLAIDPKFIMLDEPFAGVDPIAVEDIQ
QIVWKLKDKNIGILITDHNVQETLSITDRAYLLFEGKILFQGTPEELAENKIVREKYLSN
SFVLRRKDFQLNKDE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory