Comparing 353455 FitnessBrowser__Btheta:353455 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6neeB Crystal structure of a reconstructed ancestor of triosephosphate isomerase from eukaryotes (see paper)
50% identity, 98% coverage: 2:249/252 of query aligns to 4:250/252 of 6neeB
4y96A Crystal structure of triosephosphate isomerase from gemmata obscuriglobus (see paper)
46% identity, 98% coverage: 2:249/252 of query aligns to 2:248/250 of 4y96A
P36204 Bifunctional PGK/TIM; EC 2.7.2.3; EC 5.3.1.1 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
46% identity, 95% coverage: 2:241/252 of query aligns to 402:641/654 of P36204
Sites not aligning to the query:
6oogA Crystal structure of triosephosphate isomerase from taenia solium in complex with 2pg (see paper)
49% identity, 98% coverage: 2:249/252 of query aligns to 5:250/252 of 6oogA
3uwzA Crystal structure of staphylococcus aureus triosephosphate isomerase complexed with glycerol-2-phosphate (see paper)
44% identity, 98% coverage: 1:248/252 of query aligns to 2:251/254 of 3uwzA
3uwwA Crystal structure of staphylococcus aureus triosephosphate isomerase complexed with 3-phosphoglyceric acid (see paper)
44% identity, 98% coverage: 1:248/252 of query aligns to 2:251/254 of 3uwwA
3uwuA Crystal structure of staphylococcus aureus triosephosphate isomerase complexed with glycerol-3-phosphate (see paper)
44% identity, 98% coverage: 1:248/252 of query aligns to 1:250/253 of 3uwuA
Q6GIL6 Triosephosphate isomerase; TIM; TPI; Triose-phosphate isomerase; EC 5.3.1.1 from Staphylococcus aureus (strain MRSA252) (see paper)
44% identity, 98% coverage: 1:248/252 of query aligns to 1:250/253 of Q6GIL6
3uwvA Crystal structure of staphylococcus aureus triosephosphate isomerase complexed with 2-phosphoglyceric acid (see paper)
44% identity, 98% coverage: 1:248/252 of query aligns to 3:252/255 of 3uwvA
5eywA Crystal structure of litopenaeus vannamei triosephosphate isomerase complexed with 2-phosphoglycolic acid (see paper)
48% identity, 98% coverage: 2:249/252 of query aligns to 1:243/244 of 5eywA
P00943 Triosephosphate isomerase; TIM; TPI; Triose-phosphate isomerase; EC 5.3.1.1 from Geobacillus stearothermophilus (Bacillus stearothermophilus) (see 2 papers)
43% identity, 99% coverage: 1:249/252 of query aligns to 1:249/253 of P00943
1btmA Triosephosphate isomerase (tim) complexed with 2-phosphoglycolic acid (see paper)
43% identity, 98% coverage: 2:249/252 of query aligns to 1:248/251 of 1btmA
P27876 Triosephosphate isomerase; TIM; TPI; Triose-phosphate isomerase; EC 5.3.1.1 from Bacillus subtilis (strain 168) (see paper)
41% identity, 98% coverage: 1:248/252 of query aligns to 1:248/253 of P27876
A0A1L5YRA2 Triosephosphate isomerase; TIM; Allergen Scy p 8; Methylglyoxal synthase; Triose-phosphate isomerase; Allergen Scy p 8.0101; EC 5.3.1.1; EC 4.2.3.3 from Scylla paramamosain (Mud crab) (see paper)
47% identity, 98% coverage: 2:249/252 of query aligns to 5:246/248 of A0A1L5YRA2
1amkA Leishmania mexicana triose phosphate isomerase (see paper)
44% identity, 97% coverage: 5:249/252 of query aligns to 7:248/250 of 1amkA
P00942 Triosephosphate isomerase; TIM; Triose-phosphate isomerase; EC 5.3.1.1 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see 2 papers)
46% identity, 99% coverage: 2:251/252 of query aligns to 3:248/248 of P00942
Sites not aligning to the query:
3uwzB Crystal structure of staphylococcus aureus triosephosphate isomerase complexed with glycerol-2-phosphate (see paper)
43% identity, 98% coverage: 1:248/252 of query aligns to 1:247/250 of 3uwzB
2y63A Crystal structure of leishmanial e65q-tim complexed with bromohydroxyacetone phosphate (see paper)
44% identity, 97% coverage: 5:249/252 of query aligns to 6:247/249 of 2y63A
2y61A Crystal structure of leishmanial e65q-tim complexed with s-glycidol phosphate (see paper)
44% identity, 97% coverage: 5:249/252 of query aligns to 6:247/249 of 2y61A
2vxnA E65q-tim complexed with phosphoglycolohydroxamate at 0.82 a resolution (see paper)
44% identity, 97% coverage: 5:249/252 of query aligns to 6:247/249 of 2vxnA
>353455 FitnessBrowser__Btheta:353455
MRKNIVAGNWKMNKTLQEGIALAKELNEALANEKPNCDVIICTPFIHLASVTPLVDAAKI
GVGAENCADKASGAYTGEVSAEMVASTGAKYVILGHSERRAYYGETVAILEEKVKLALAN
GLTPIFCIGEVLEEREANKQNEVVAAQMESVFSLSAEDFSKIILAYEPVWAIGTGKTASP
EQAQEIHAFIRSIVADKYGKEIADNTSILYGGSCKPSNAKELFSNPDVDGGLIGGAALKV
SDFKGIIDAFNA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory