Comparing 353459 FitnessBrowser__Btheta:353459 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
3ggoA Crystal structure of prephenate dehydrogenase from a. Aeolicus with hpp and nadh (see paper)
23% identity, 98% coverage: 3:255/257 of query aligns to 8:281/285 of 3ggoA
3ggpA Crystal structure of prephenate dehydrogenase from a. Aeolicus in complex with hydroxyphenyl propionate and NAD+ (see paper)
23% identity, 98% coverage: 3:255/257 of query aligns to 8:281/286 of 3ggpA
3gggD The crystal structure of a. Aeolicus prephenate dehydrogenase in complex with tyrosine and NAD+ (see paper)
23% identity, 98% coverage: 3:255/257 of query aligns to 16:289/293 of 3gggD
2pv7B Crystal structure of chorismate mutase / prephenate dehydrogenase (tyra) (1574749) from haemophilus influenzae rd at 2.00 a resolution (see paper)
20% identity, 77% coverage: 56:254/257 of query aligns to 55:260/280 of 2pv7B
Sites not aligning to the query:
>353459 FitnessBrowser__Btheta:353459
MRILILGAGKMGSFFTDILSFQHETAVFDVNPHQLRFVYNTYRFTTLEEIKEFEPELVIN
AVTVKYTLDAFRKVLPVLPKDCIISDIASVKTGLKKFYEESGFRYVSSHPMFGPTFASLS
NLSSENAIIISEGDHLGKIFFKDLYQTLRLNIFEYTFDEHDETVAYSLSIPFVSTFVFAA
VMKHQEAPGTTFKKHMAIAKGLLSEDDYLLQEILFNPRTPGQVANIRTELKNLLEIIEKK
DAEGMKAYLTKIREKIK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory