Comparing 353461 FitnessBrowser__Btheta:353461 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6l1oB Product bound bacf structure from bacillus subtillis (see paper)
36% identity, 98% coverage: 9:393/393 of query aligns to 2:388/392 of 6l1oB
6l1lB Apo-bacf structure from bacillus subtillis (see paper)
36% identity, 98% coverage: 9:393/393 of query aligns to 2:388/393 of 6l1lB
6l1nA Substrate bound bacf structure from bacillus subtillis (see paper)
36% identity, 98% coverage: 9:393/393 of query aligns to 2:387/393 of 6l1nA
2x5dD Crystal structure of a probable aminotransferase from pseudomonas aeruginosa (see paper)
34% identity, 91% coverage: 37:392/393 of query aligns to 15:374/380 of 2x5dD
2o1bA Structure of aminotransferase from staphylococcus aureus
30% identity, 90% coverage: 41:393/393 of query aligns to 21:372/376 of 2o1bA
1gdeA Crystal structure of pyrococcus protein a-1 e-form (see paper)
30% identity, 97% coverage: 11:392/393 of query aligns to 1:381/388 of 1gdeA
1gd9A Crystall structure of pyrococcus protein-a1 (see paper)
30% identity, 97% coverage: 11:392/393 of query aligns to 1:381/388 of 1gd9A
1o4sB Crystal structure of aspartate aminotransferase (tm1255) from thermotoga maritima at 1.90 a resolution (see paper)
28% identity, 95% coverage: 19:390/393 of query aligns to 14:379/384 of 1o4sB
P14909 Aspartate aminotransferase; AspAT; Transaminase A; EC 2.6.1.1 from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see 3 papers)
26% identity, 93% coverage: 29:393/393 of query aligns to 23:395/402 of P14909
Sites not aligning to the query:
Q58097 (5-formylfuran-3-yl)methyl phosphate transaminase; 4-HFC-P:alanine aminotransferase; EC 2.6.1.108 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
30% identity, 97% coverage: 13:392/393 of query aligns to 3:367/370 of Q58097
1bkgA Aspartate aminotransferase from thermus thermophilus with maleate (see paper)
28% identity, 92% coverage: 33:392/393 of query aligns to 25:381/382 of 1bkgA
1bjwA Aspartate aminotransferase from thermus thermophilus (see paper)
28% identity, 92% coverage: 33:392/393 of query aligns to 25:381/382 of 1bjwA
P58350 Aspartate aminotransferase; AAT; AspAT; Putative 2-aminoadipate transaminase; Transaminase A; EC 2.6.1.1; EC 2.6.1.39 from Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti) (see paper)
28% identity, 96% coverage: 12:389/393 of query aligns to 14:402/410 of P58350
Q56232 Aspartate/prephenate aminotransferase; AspAT / PAT; Transaminase A; EC 2.6.1.1; EC 2.6.1.78 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see 3 papers)
28% identity, 92% coverage: 33:392/393 of query aligns to 25:381/385 of Q56232
Sites not aligning to the query:
6f35A Crystal structure of the aspartate aminotranferase from rhizobium meliloti (see paper)
28% identity, 96% coverage: 12:389/393 of query aligns to 4:392/400 of 6f35A
1b5oA Thermus thermophilus aspartate aminotransferase single mutant 1 (see paper)
28% identity, 92% coverage: 33:392/393 of query aligns to 25:381/382 of 1b5oA
1gc4A Thermus thermophilus aspartate aminotransferase tetra mutant 2 complexed with aspartate (see paper)
28% identity, 92% coverage: 33:392/393 of query aligns to 25:381/382 of 1gc4A
1gc3A Thermus thermophilus aspartate aminotransferase tetra mutant 2 complexed with tryptophan (see paper)
28% identity, 92% coverage: 33:392/393 of query aligns to 25:381/382 of 1gc3A
Sites not aligning to the query:
1xi9C Alanine aminotransferase from pyrococcus furiosus pfu-1397077-001
27% identity, 97% coverage: 13:392/393 of query aligns to 2:389/393 of 1xi9C
Q02635 Aspartate/prephenate aminotransferase; AspAT / PAT; Transaminase A; EC 2.6.1.1; EC 2.6.1.79 from Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti) (see paper)
27% identity, 96% coverage: 15:392/393 of query aligns to 10:395/400 of Q02635
>353461 FitnessBrowser__Btheta:353461
MQKESQTYKIAPAERLASVSEYYFSKKLKEVAQMNAEGKDVISLGIGSPDMPPSKVTIET
LCNNAHDPNGHGYQPYVGIPELRKGFAAWYQRWYGVELNPNTEIQPLIGSKEGILHVTLA
FVNPGEQVLVPNPGYPTYTSLSKILGAEVISYDLKEEDGWMPDFEALEKMDLNRVKLMWT
NYPNMPTGANATPELYERLVDFARRKNIVIVNDNPYSFILNEKPISILSVPGAKECCIEF
NSMSKSHNMPGWRIGMLASNAEFVQWILKVKSNIDSGMFRAMQLAAATALEAEADWYEGN
NHNYRGRRHLAGEIMKTLGCTYDENQVGMFLWGKIPASCKDVEELTEKVLHQARVFITPG
FIFGSNGARFIRISLCCKDAKLAEALERIKKLS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory