SitesBLAST
Comparing 353631 FitnessBrowser__Btheta:353631 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 11 hits to proteins with known functional sites (download)
P0AA76 D-galactonate transporter; D-galactonate/H(+) symporter from Escherichia coli (strain K12) (see paper)
27% identity, 58% coverage: 5:292/495 of query aligns to 14:273/430 of P0AA76
- Y29 (= Y20) binding
- D31 (= D22) mutation to N: Loss of galactonate transport activity.
- R32 (= R23) binding
- Y64 (= Y56) binding
- E118 (= E139) mutation to Q: Loss of galactonate transport activity.
Sites not aligning to the query:
6e9nA E. Coli d-galactonate:proton symporter in the inward open form (see paper)
27% identity, 58% coverage: 5:292/495 of query aligns to 3:254/409 of 6e9nA
Sites not aligning to the query:
6e9oA E. Coli d-galactonate:proton symporter mutant e133q in the outward substrate-bound form (see paper)
26% identity, 56% coverage: 5:279/495 of query aligns to 6:239/393 of 6e9oA
Sites not aligning to the query:
Q9JI12 Vesicular glutamate transporter 2; VGluT2; Differentiation-associated BNPI; Differentiation-associated Na(+)-dependent inorganic phosphate cotransporter; Solute carrier family 17 member 6 from Rattus norvegicus (Rat) (see 2 papers)
24% identity, 61% coverage: 116:419/495 of query aligns to 168:467/582 of Q9JI12
- R184 (= R132) mutation R->A,E,K: Greatly lowers L-glutamate transport.
- E191 (= E139) mutation to A: Greatly lowers L-glutamate transport.; mutation E->D,Q: Lowers L-glutamate transport.
- R322 (≠ T271) mutation to A: Loss of L-glutamate release. Abolishes the chloride ion conductance.
Sites not aligning to the query:
- 88 R→A: Impairs synaptic transmission. Abolishes the chloride ion conductance.
- 128 H→A: Greatly lowers L-glutamate transport.
7t3nA R184q/e191q mutant of rat vesicular glutamate transporter 2 (vglut2)
24% identity, 63% coverage: 106:419/495 of query aligns to 99:409/452 of 7t3nA
Sites not aligning to the query:
Q9NRA2 Sialin; H(+)/nitrate cotransporter; H(+)/sialic acid cotransporter; AST; Membrane glycoprotein HP59; Solute carrier family 17 member 5; Vesicular excitatory amino acid transporter; VEAT from Homo sapiens (Human) (see 8 papers)
21% identity, 57% coverage: 5:288/495 of query aligns to 39:318/495 of Q9NRA2
- R39 (= R5) to C: in SD; frequent variant in Finland; alters intracellular localization, only partially targeted to lysosomes and mainly detected in LAMP1-negative vesicles and in the Golgi apparatus; completely devoid of L-aspartate and L-glutamate transport activity, but retains appreciable H(+)-coupled sialic acid and nitrate transporter activity; dbSNP:rs80338794
- K136 (≠ H104) to E: in SD; alters intracellular localization, only partially targeted to lysosomes and mainly detected in LAMP1-negative vesicles and in the Golgi apparatus; completely devoid of L-aspartate and L-glutamate transporter activity, but retains appreciable H(+)-coupled sialic acid transporter activity; dbSNP:rs80338795
- H183 (≠ I147) to R: in ISSD; alters intracellular localization, only partially targeted to lysosomes and mainly detected in LAMP1-negative vesicles and in the Golgi apparatus; abolishes H(+)-coupled sialic acid transporter activity; has normal L-aspartate and L-glutamate transporter activity; dbSNP:rs119491109
- LL 198:199 (≠ AT 162:163) mutation to AA: Localizes in vesicular structures mainly concentrated in the perinuclear region.
- IL 266:267 (≠ IE 229:230) mutation to LA: Localizes in vesicular structures mainly concentrated in the perinuclear region.
- SSL-------RN 268:272 (≠ QDQNEAGAGPKT 231:242) natural variant: Missing (in ISSD; alters intracellular localization, only partially targeted to lysosomes and mainly detected in LAMP1-negative vesicles and in the Golgi apparatus; abolishes H(+)-coupled sialic acid transporter activity; has normal L-aspartate and L-glutamate transporter activity)
Sites not aligning to the query:
- 22:23 Dileucine internalization motif; LL→AA: Targeted to plasma membrane.; LL→GG: Targeted to plasma membrane; sialic acid uptake strongly activated at acidic pH.
- 328 G → E: in ISSD; some patients may manifest a milder phenotype consistent with Salla disease; markedly decreases H(+)-coupled sialic acid transporter activity; abolishes L-aspartate and L-glutamate transporter activity; dbSNP:rs386833996
- 334 P → R: in ISSD; does not affect intracellular localization, targeted to lysosomes; abolishes H(+)-coupled sialic acid transporter activity; abolishes L-aspartate and L-glutamate transporter activity; dbSNP:rs119491110
- 371 G → V: in ISSD; abolishes H(+)-coupled sialic acid transporter activity; abolishes L-aspartate and L-glutamate transporter activity; dbSNP:rs777862172
Q5Q0U0 Sialin; H(+)/nitrate cotransporter; H(+)/sialic acid cotransporter; AST; Solute carrier family 17 (Anion/sugar transporter), member 5; Vesicular excitatory amino acid transporter; VEAT from Rattus norvegicus (Rat) (see 2 papers)
22% identity, 35% coverage: 121:295/495 of query aligns to 157:327/495 of Q5Q0U0
- R168 (= R132) mutation to C: Abolishes H(+)-coupled sialic acid transporter activity.
- E171 (≠ L135) mutation to C: Decreases H(+)-coupled sialic acid transporter activity; when associated with C-175.
- G172 (≠ A136) mutation to C: Decreases protein levels and alters subcellular localization.
- E175 (= E139) mutation to C: Decreases H(+)-coupled sialic acid transporter activity; when associated with C-171.
- G176 (≠ A140) mutation to C: Decreases protein levels and alters subcellular localization.
- F179 (= F143) mutation to C: Decreases the affinity and transport rate for D-glucuronate. Does not affect H(+)-coupled sialic acid transporter activity.
- P180 (= P144) mutation to C: Decreases protein levels and alters subcellular localization.
- H183 (≠ I147) mutation to R: Abolishes H(+)-coupled sialic acid transporter activity.
- W186 (≠ T150) mutation to C: Abolishes H(+)-coupled sialic acid transporter activity.
- SSL-------KN 268:272 (≠ QDQNEAGAGPKT 231:242) mutation Missing: Abolishes H(+)-coupled sialic acid transporter activity.
Sites not aligning to the query:
- 22:23 Dileucine internalization motif; LL→AA: Targeted to plasma membrane; sialic acid uptake strongly activated at acidic pH.
- 39 R→C: Markedly decreases H(+)-coupled sialic acid transporter activity.
- 136 K→E: Markedly decreases H(+)-coupled sialic acid transporter activity.
- 334 P→R: Abolishes H(+)-coupled sialic acid transporter activity.
- 371 G→V: Remains in the endoplasmic reticulum.
Q8BN82 Sialin; H(+)/nitrate cotransporter; H(+)/sialic acid cotransporter; AST; Solute carrier family 17 member 5; Vesicular excitatory amino acid transporter; VEAT from Mus musculus (Mouse) (see paper)
23% identity, 34% coverage: 121:287/495 of query aligns to 157:317/495 of Q8BN82
- H183 (≠ I147) mutation to R: Abolishes sialic acid transporter activity. Does not affect L-aspartate and L-glutamate transporter activity.
Sites not aligning to the query:
- 39 R→C: Completely abolishes L-aspartate and L-glutamate transporter activity. Retains appreciable H(+)-coupled sialic acid transporter activity.
Q9Y2C5 Probable small intestine urate exporter; Solute carrier family 17 member 4 from Homo sapiens (Human) (see 2 papers)
23% identity, 40% coverage: 155:354/495 of query aligns to 193:386/497 of Q9Y2C5
- A372 (≠ L340) to T: in dbSNP:rs11754288
Sites not aligning to the query:
- 66 modified: carbohydrate, N-linked (GlcNAc...) asparagine; N→A: Loss of glycosylation and significant reduction in the transport of thyroid hormones T3 and T4; when associated with A-75 and A-90.
- 75 modified: carbohydrate, N-linked (GlcNAc...) asparagine; N→A: Loss of glycosylation and significant reduction in the transport of thyroid hormones T3 and T4; when associated with A-66 and A-90.
- 90 modified: carbohydrate, N-linked (GlcNAc...) asparagine; N→A: Loss of glycosylation and significant reduction in the transport of thyroid hormones T3 and T4; when associated with A-75 and A-90.
Q03567 Uncharacterized transporter slc-17.2 from Caenorhabditis elegans (see paper)
22% identity, 65% coverage: 18:341/495 of query aligns to 56:352/493 of Q03567
- N69 (≠ D31) modified: carbohydrate, N-linked (GlcNAc...) asparagine
Q6ZSM3 Monocarboxylate transporter 12; MCT 12; Creatine transporter 2; CRT2; Solute carrier family 16 member 12 from Homo sapiens (Human) (see 3 papers)
25% identity, 34% coverage: 98:263/495 of query aligns to 113:263/516 of Q6ZSM3
Sites not aligning to the query:
- 67 R→A: Abolishes creatine efflux activity. Does not affect plasma membrane localization.
- 95 D→A: Decreases in the creatine efflux activity. Does not affect plasma membrane localization.
- 245:516 natural variant: Missing (in CTRCT47; loss of localization to the plasma membrane; retained in the endoplasmic reticulum where it undergoes degradation by the proteasome; has no dominant effect on wild-type protein expression and localization)
- 329 D→A: Decreases creatine efflux activity. Loss of localization to the plasma membrane.
- 360 D→A: Does not affect creatine efflux activity. Does not affect plasma membrane localization.
- 387 D→A: Does not affect creatine efflux activity.
- 437 G → S: found in a patient with age-related cataract; uncertain significance; decreases creatine transport; dbSNP:rs759863805
Query Sequence
>353631 FitnessBrowser__Btheta:353631
MTNYRWTICAMLFFATTVNYLDRQVLSLTWDEFIKPEFHWDESHYGTITSVFSIVYAICM
LFAGRFVDWMGTKKGFLWAIGVWSAGACLHAVCGIVTEAQVGLHSAAELAGATGDVVVTI
ATVSMYCFLAARCILALGEAGNFPAAIKVTAEYFPKKDRAYATSIFNAGASIGALIAPLT
IPILAKAFGWEMAFIVIGGLGFIWMGFWVFMYDAPSKSKHVNKAELEYIEQDQNEAGAGP
KTEEKDEKKMRFWQCFSYKQTWAFVFGKFTTDGVWWFFLFWTPSYLNSQFGIKTSDPLGM
GLIFTLYAITMLSIYGGKLPTIFINKTGMNPYAARMKAMLIFAFFPLVVLLAQPLGTFSP
WFPVILIGIGGAAHQSWSANIFSTVGDMFPRTAIASITGIGGMAGGIGSMILQKVAGNLF
VYASGTTMVDGKEVEMTKELLEQGAQFVHPAMTFMGFEGKPAGYFVIFCVCAVAYLIGWV
IMKALVPKYKPIVLD
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory