Comparing 353664 FitnessBrowser__Btheta:353664 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4dq6A Crystal structure of plp-bound putative aminotransferase from clostridium difficile 630
41% identity, 99% coverage: 1:387/389 of query aligns to 1:388/388 of 4dq6A
6qp3A Crystal structure of the plp-bound c-s lyase from bacillus subtilis (strain 168) (see paper)
42% identity, 99% coverage: 4:387/389 of query aligns to 2:387/387 of 6qp3A
1c7oA Crystal structure of cystalysin from treponema denticola contains a pyridoxal 5'-phosphate-l-aminoethoxyvinylglycine complex (see paper)
34% identity, 100% coverage: 1:388/389 of query aligns to 1:392/394 of 1c7oA
1c7nA Crystal structure of cystalysin from treponema denticola contains a pyridoxal 5'-phosphate cofactor (see paper)
34% identity, 100% coverage: 1:388/389 of query aligns to 1:392/394 of 1c7nA
3b1eA Crystal structure of betac-s lyase from streptococcus anginosus in complex with l-serine: alpha-aminoacrylate form (see paper)
36% identity, 98% coverage: 3:382/389 of query aligns to 3:381/387 of 3b1eA
3b1dA Crystal structure of betac-s lyase from streptococcus anginosus in complex with l-serine: external aldimine form (see paper)
36% identity, 98% coverage: 3:382/389 of query aligns to 3:381/387 of 3b1dA
3b1cA Crystal structure of betac-s lyase from streptococcus anginosus: internal aldimine form (see paper)
36% identity, 98% coverage: 3:382/389 of query aligns to 3:381/387 of 3b1cA
5z0qC Crystal structure of ovob (see paper)
37% identity, 99% coverage: 3:388/389 of query aligns to 1:377/379 of 5z0qC
3l8aB Crystal structure of metc from streptococcus mutans
32% identity, 98% coverage: 3:382/389 of query aligns to 2:379/385 of 3l8aB
8bobA Structural basis for negative regulation of the maltose system (see paper)
33% identity, 99% coverage: 3:386/389 of query aligns to 2:386/390 of 8bobA
P23256 Protein MalY; EC 4.4.1.13 from Escherichia coli (strain K12) (see 2 papers)
33% identity, 99% coverage: 3:386/389 of query aligns to 2:386/390 of P23256
6qp1B Crystal structure of the plp-bound c-s lyase in the external aldimine form from staphylococcus hominis complexed with an inhibitor, l- cycloserine. (see paper)
35% identity, 99% coverage: 1:386/389 of query aligns to 6:397/398 of 6qp1B
6qp2A Crystal structure of the plp-bound c-s lyase from staphylococcus hominis (see paper)
35% identity, 99% coverage: 3:386/389 of query aligns to 1:378/383 of 6qp2A
7qugA Crystal structure of carbon-sulfur lyase fnapatb1 from fusobacterium nucleatum subspecies animalis in complex with allyl-cysteine (see paper)
34% identity, 99% coverage: 3:389/389 of query aligns to 2:397/397 of 7qugA
1gdeA Crystal structure of pyrococcus protein a-1 e-form (see paper)
25% identity, 93% coverage: 27:389/389 of query aligns to 23:385/388 of 1gdeA
1gd9A Crystall structure of pyrococcus protein-a1 (see paper)
25% identity, 93% coverage: 27:389/389 of query aligns to 23:385/388 of 1gd9A
P14909 Aspartate aminotransferase; AspAT; Transaminase A; EC 2.6.1.1 from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see 3 papers)
21% identity, 92% coverage: 31:389/389 of query aligns to 37:402/402 of P14909
Sites not aligning to the query:
1xi9C Alanine aminotransferase from pyrococcus furiosus pfu-1397077-001
25% identity, 86% coverage: 57:389/389 of query aligns to 61:393/393 of 1xi9C
5wmiA Arabidopsis thaliana prephenate aminotransferase mutant- t84v (see paper)
25% identity, 92% coverage: 31:386/389 of query aligns to 31:396/402 of 5wmiA
Sites not aligning to the query:
5wmhA Arabidopsis thaliana prephenate aminotransferase (see paper)
25% identity, 92% coverage: 31:386/389 of query aligns to 31:396/399 of 5wmhA
>353664 FitnessBrowser__Btheta:353664
MNYNFDEIINRNGTDSVKWDAVERRWGRNDLIPMWVADMDFRTAPFVIDALKKRLDHEVL
GYTFACKEWAESIINWLKERHGWEIREDMLTFTPGIVRGLAFAIHCFTEKGDKVMVMPPV
YHPFFLVTQKNEREVVYSPLVLKDGQYHIDFDRFRKDVQGCKLLILSNPHNPGGRVWTKE
ELSQIADICYENGTLVISDEIHADLTLPPYKHPTFALISEKARMNSLVFMSPSKAFNMPG
LASSYAIIENDELRHQFQVYMEASEFSEGHLFAYLSVAAAYSHGTEWLDQVVAYIKGNID
FTESYLKERIPAIRMIRPQASYLIFLDCRELGLNQEELNRLFVEDAHLALNEGTTFGKEG
EGFMRLNVACPRATLEKALRQLEQAVNNR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory