SitesBLAST
Comparing 353741 FitnessBrowser__Btheta:353741 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2hk9B Crystal structure of shikimate dehydrogenase from aquifex aeolicus in complex with shikimate and NADP+ at 2.2 angstrom resolution (see paper)
36% identity, 98% coverage: 4:247/248 of query aligns to 9:251/267 of 2hk9B
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V67 (≠ I61), G130 (= G128), G133 (= G131), A134 (= A132), N153 (≠ S151), R154 (= R152), T155 (= T153), K158 (≠ T156), T188 (= T180), S189 (≠ P181), V190 (= V182), I214 (≠ L208), M238 (= M234), L239 (= L235)
- binding (3r,4s,5r)-3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid: S19 (= S14), S21 (= S16), N64 (= N58), T66 (= T60), K70 (= K64), N91 (= N85), D106 (= D105), Y216 (= Y210), L239 (= L235), Q242 (= Q238)
O67049 Shikimate dehydrogenase (NADP(+)); SD; SDH; EC 1.1.1.25 from Aquifex aeolicus (strain VF5) (see paper)
36% identity, 98% coverage: 4:247/248 of query aligns to 9:251/269 of O67049
2hk9A Crystal structure of shikimate dehydrogenase from aquifex aeolicus in complex with shikimate and NADP+ at 2.2 angstrom resolution (see paper)
36% identity, 98% coverage: 4:247/248 of query aligns to 9:251/269 of 2hk9A
- binding 2'-monophosphoadenosine-5'-diphosphate: V67 (≠ I61), G132 (= G130), G133 (= G131), A134 (= A132), N153 (≠ S151), R154 (= R152), T155 (= T153), T188 (= T180), S189 (≠ P181), V190 (= V182)
- binding (3r,4s,5r)-3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid: S19 (= S14), S21 (= S16), N64 (= N58), K70 (= K64), N91 (= N85), D106 (= D105), Y216 (= Y210), L239 (= L235), Q242 (= Q238)
Q58484 Shikimate dehydrogenase (NADP(+)); SDH; EC 1.1.1.25 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (see paper)
33% identity, 98% coverage: 5:246/248 of query aligns to 10:262/282 of Q58484
1nvtB Crystal structure of shikimate dehydrogenase (aroe or mj1084) in complex with NADP+ (see paper)
33% identity, 98% coverage: 5:246/248 of query aligns to 15:267/287 of 1nvtB
- active site: K75 (= K64), D111 (= D105)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: I72 (= I61), G135 (vs. gap), G137 (≠ T129), G138 (= G130), A139 (≠ G131), N157 (≠ S151), R158 (= R152), T159 (= T153), K162 (≠ T156), A200 (≠ C179), T201 (= T180), P202 (= P181), I203 (≠ V182), M205 (= M184), L229 (= L208), Y231 (= Y210), M255 (= M234), L256 (= L235)
- binding zinc ion: E22 (≠ R12), H23 (= H13)
1nvtA Crystal structure of shikimate dehydrogenase (aroe or mj1084) in complex with NADP+ (see paper)
33% identity, 98% coverage: 5:246/248 of query aligns to 15:267/287 of 1nvtA
- active site: K75 (= K64), D111 (= D105)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G135 (vs. gap), A139 (≠ G131), N157 (≠ S151), R158 (= R152), T159 (= T153), K162 (≠ T156), A200 (≠ C179), T201 (= T180), P202 (= P181), I203 (≠ V182), M205 (= M184), L229 (= L208), Y231 (= Y210), G252 (= G231), M255 (= M234), L256 (= L235)
2gptA Crystal structure of arabidopsis dehydroquinate dehydratase-shikimate dehydrogenase in complex with tartrate and shikimate (see paper)
33% identity, 98% coverage: 4:246/248 of query aligns to 237:472/498 of 2gptA
- binding (3r,4s,5r)-3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid: I239 (≠ L6), S247 (= S14), S249 (= S16), T292 (= T60), K296 (= K64), N317 (= N85), D334 (= D105), Y436 (= Y210), Q464 (= Q238), Q468 (≠ A242)
Sites not aligning to the query:
Q5HNV1 Shikimate dehydrogenase (NADP(+)); SDH; EC 1.1.1.25 from Staphylococcus epidermidis (strain ATCC 35984 / RP62A) (see paper)
30% identity, 98% coverage: 3:246/248 of query aligns to 2:247/269 of Q5HNV1
- SLS 13:15 (≠ SFS 14:16) binding
- T60 (= T60) binding
- N85 (= N85) binding
- D100 (= D105) binding
- Y211 (= Y210) Plays a major role in the catalytic process and a minor role in the substrate binding; mutation to F: Leads to a 345-fold decrease in the catalytic efficiency and a 3-fold decrease in the affinity binding for shikimate.
- Q239 (= Q238) binding
6bmqA Crystal structure of arabidopsis dehydroquinate dehydratase-shikimate dehydrogenase (t381g mutant) in complex with tartrate and shikimate (see paper)
33% identity, 98% coverage: 4:246/248 of query aligns to 237:472/498 of 6bmqA
- binding (1S,3R,4S,5R)-1,3,4,5-tetrahydroxycyclohexanecarboxylic acid: S247 (= S14), S249 (= S16), C291 (≠ V59), K296 (= K64), N317 (= N85), D334 (= D105), Y436 (= Y210), Q464 (= Q238)
Sites not aligning to the query:
Q9SQT8 Bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase, chloroplastic; DHQ-SDH protein; DHQase-SORase; Protein EMBRYO DEFECTIVE 3004; EC 4.2.1.10; EC 1.1.1.25 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
32% identity, 98% coverage: 4:246/248 of query aligns to 326:586/603 of Q9SQT8
- S336 (= S14) binding ; mutation to A: 13-fold decrease in substrate affinity but almost no change in activity.
- S338 (= S16) binding ; mutation to A: 10-fold decrease in activity, and 9-fold decrease in substrate affinity.
- T381 (= T60) binding
- K385 (= K64) binding ; mutation to A: Strongly reduced shikimate dehydrogenase activity, but minor change in substrate affinity.; mutation to N: Strongly reduced shikimate dehydrogenase activity, but no change in substrate affinity.
- N406 (= N85) binding
- D423 (= D105) binding ; mutation to A: Loss of shikimate dehydrogenase activity.; mutation to N: Reduced shikimate dehydrogenase activity, but no change in substrate affinity.
- A461 (≠ T129) binding
- G463 (= G131) binding
- A464 (= A132) binding
- N483 (≠ S151) binding
- T485 (= T153) binding
- R488 (≠ T156) binding
- M525 (= M184) binding
- A548 (≠ L208) binding
- Y550 (= Y210) binding ; mutation Y->F,A: 100-fold decrease in activity, and 2-fold decrease in substrate affinity.
- G571 (= G231) binding
- Q578 (= Q238) binding
- Q582 (≠ A242) binding
Sites not aligning to the query:
- 124 binding
- 126 binding
- 155 binding
- 241 binding
- 279 binding
- 300 binding
- 304 binding
3dooA Crystal structure of shikimate dehydrogenase from staphylococcus epidermidis complexed with shikimate (see paper)
29% identity, 98% coverage: 3:246/248 of query aligns to 2:238/258 of 3dooA
- binding (3r,4s,5r)-3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid: S13 (= S14), S15 (= S16), N58 (= N58), T60 (= T60), K64 (= K64), N85 (= N85), D100 (= D105), F227 (≠ L235), Q230 (= Q238)
2o7sA Crystal structure of the a. Thaliana dhq-dehydroshikimate-sdh- shikimate-NADP(h)
33% identity, 98% coverage: 4:246/248 of query aligns to 237:474/500 of 2o7sA
- binding 3-dehydroshikimate: I239 (≠ L6), S247 (= S14), S249 (= S16), T292 (= T60), K296 (= K64), N317 (= N85), D334 (= D105), Y438 (= Y210), Q466 (= Q238), Q470 (≠ A242)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: I293 (= I61), P294 (= P62), K296 (= K64), D334 (= D105), G354 (= G130), G355 (= G131), A356 (= A132), N374 (≠ S151), R375 (= R152), T376 (= T153), R379 (≠ T156), T409 (= T180), S410 (≠ P181), M411 (≠ V182), A436 (≠ L208), M462 (= M234), F463 (≠ L235)
Sites not aligning to the query:
2o7qA Crystal structure of the a. Thaliana dhq-dehydroshikimate-sdh- shikimate-NADP(h)
32% identity, 98% coverage: 4:246/248 of query aligns to 237:475/501 of 2o7qA
Sites not aligning to the query:
3tnlA 1.45 angstrom crystal structure of shikimate 5-dehydrogenase from listeria monocytogenes in complex with shikimate and NAD.
30% identity, 99% coverage: 2:246/248 of query aligns to 11:273/288 of 3tnlA
- binding nicotinamide-adenine-dinucleotide: M71 (≠ I61), G134 (= G128), A135 (≠ T129), G136 (= G130), G137 (= G131), A138 (= A132), N158 (vs. gap), R159 (vs. gap), D161 (vs. gap), F163 (vs. gap), T207 (= T180), V209 (= V182), M211 (= M184), F214 (≠ K187), V235 (≠ L208), Y237 (= Y210), M261 (= M234), M262 (≠ L235)
- binding (3r,4s,5r)-3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid: S23 (= S14), S25 (= S16), N68 (= N58), S70 (≠ T60), K74 (= K64), N95 (= N85), D110 (= D105), Q265 (= Q238)
3tozA 2.2 angstrom crystal structure of shikimate 5-dehydrogenase from listeria monocytogenes in complex with NAD.
30% identity, 99% coverage: 2:246/248 of query aligns to 14:276/291 of 3tozA
- binding nicotinamide-adenine-dinucleotide: G137 (= G128), A138 (≠ T129), G139 (= G130), G140 (= G131), A141 (= A132), N161 (vs. gap), R162 (vs. gap), D164 (vs. gap), F166 (vs. gap), T210 (= T180), G211 (≠ P181), V212 (= V182), M214 (= M184), F217 (≠ K187), V238 (≠ L208), Y240 (= Y210), G261 (= G231), M264 (= M234), M265 (≠ L235)
Q8Y9N5 Shikimate dehydrogenase (NADP(+)); SDH; EC 1.1.1.25 from Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e)
30% identity, 99% coverage: 2:246/248 of query aligns to 14:276/291 of Q8Y9N5
- SLS 26:28 (≠ SFS 14:16) binding
- NRKD 161:164 (vs. gap) binding
- M214 (= M184) binding
1nytA Shikimate dehydrogenase aroe complexed with NADP+ (see paper)
30% identity, 100% coverage: 1:247/248 of query aligns to 1:253/271 of 1nytA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: K65 (= K64), D102 (= D105), G128 (= G130), G129 (= G131), A130 (= A132), N149 (≠ S151), R150 (= R152), T151 (= T153), R154 (≠ T156), T188 (= T180), S189 (≠ P181), S190 (≠ V182), M213 (≠ L208), G237 (= G231), M240 (= M234), L241 (= L235)
P15770 Shikimate dehydrogenase (NADP(+)); SD; SDH; EC 1.1.1.25 from Escherichia coli (strain K12) (see paper)
30% identity, 100% coverage: 1:247/248 of query aligns to 1:253/272 of P15770
2cy0A Crystal structure of shikimate 5-dehydrogenase (aroe) from thermus thermophilus hb8 in complex with NADP (see paper)
29% identity, 99% coverage: 1:246/248 of query aligns to 1:243/262 of 2cy0A
- active site: K64 (= K64), D100 (= D105)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G123 (= G128), G126 (= G131), A127 (= A132), N146 (≠ S151), R147 (= R152), T148 (= T153), R151 (≠ T156), T179 (= T180), R180 (≠ P181), V181 (= V182), L205 (= L208), L232 (= L235)
2ev9B Crystal structure of shikimate 5-dehydrogenase (aroe) from thermus thermophilus hb8 in complex with NADP(h) and shikimate (see paper)
29% identity, 99% coverage: 1:246/248 of query aligns to 1:243/263 of 2ev9B
- active site: K64 (= K64), D100 (= D105)
- binding (3r,4s,5r)-3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid: S14 (= S14), S16 (= S16), N58 (= N58), T60 (= T60), K64 (= K64), N85 (= N85), D100 (= D105), Q235 (= Q238)
Query Sequence
>353741 FitnessBrowser__Btheta:353741
MEKYGLIGYPLRHSFSIGYFNEKFRSEGINAEYVNFEIPNINDFMEVIEENPNLCGLNVT
IPYKEQVIPFLNELDRDTAKIGAVNVIKIIRQPKGKVKLVGYNSDIIGFTQSIQPLLQPQ
HKKALILGTGGASKAVYHGLKNLGIESVFVSRTHKTDDMLTYEELTPEIMEEYTVIVNCT
PVGMYPKVDFCPNIPYELLTPNHLLYDLLYNPNVTLFMKKGEAQGAVTKNGLEMLLLQAF
AAWEIWHR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory