Comparing 353847 FitnessBrowser__Btheta:353847 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3e0iA Cu2+ substituted aquifex aeolicus kdo8ps in complex with pep (see paper)
48% identity, 95% coverage: 11:263/266 of query aligns to 2:254/263 of 3e0iA
2a21A Aquifex aeolicus kdo8ps in complex with pep, po4, and zn2+ (see paper)
48% identity, 95% coverage: 11:263/266 of query aligns to 2:254/263 of 2a21A
1jcyA Aquifex aeolicus kdo8p synthase in complex with r5p, pep and cadmium (see paper)
48% identity, 95% coverage: 11:263/266 of query aligns to 2:254/263 of 1jcyA
1fwwA Aquifex aeolicus kdo8p synthase in complex with pep, a5p and cadmium (see paper)
48% identity, 95% coverage: 11:263/266 of query aligns to 2:254/263 of 1fwwA
1fwtA Aquifex aeolicus kdo8p synthase in complex with pep, e4p and cadmium (see paper)
48% identity, 95% coverage: 11:263/266 of query aligns to 2:254/263 of 1fwtA
1pcwA Aquifex aeolicus kdo8ps in complex with cadmium and app, a bisubstrate inhibitor (see paper)
48% identity, 95% coverage: 11:263/266 of query aligns to 2:248/257 of 1pcwA
1pe1A Aquifex aeolicus kdo8ps in complex with cadmium and 2-pga (see paper)
48% identity, 95% coverage: 11:263/266 of query aligns to 3:249/258 of 1pe1A
3e12A Cu2+ substituted aquifex aeolicus kdo8ps in complex with kdo8p (see paper)
48% identity, 95% coverage: 11:263/266 of query aligns to 2:249/258 of 3e12A
2nx1A Structural and mechanistic changes along an engineered path from metallo to non-metallo kdo8p synthase (see paper)
48% identity, 95% coverage: 11:263/266 of query aligns to 2:254/263 of 2nx1A
2nx3D Structural and mechanistic changes along an engineered path from metallo to non-metallo kdo8p synthase (see paper)
48% identity, 95% coverage: 11:263/266 of query aligns to 1:253/262 of 2nx3D
1jcxA Aquifex aeolicus kdo8p synthase in complex with api and cadmium (see paper)
48% identity, 95% coverage: 11:263/266 of query aligns to 2:246/255 of 1jcxA
1pckA Aquifex aeolicus kdo8ps in complex with z-methyl-pep (see paper)
48% identity, 95% coverage: 11:263/266 of query aligns to 2:249/258 of 1pckA
3undB Substrate-bound crystal structure of 2-dehydro-3-deoxyphosphooctonate aldolase from burkholderia pseudomallei (see paper)
47% identity, 97% coverage: 9:266/266 of query aligns to 14:276/284 of 3undB
1g7vA Crystal structures of kdo8p synthase in its binary complexes with the mechanism-based inhibitor (see paper)
46% identity, 96% coverage: 12:266/266 of query aligns to 19:275/284 of 1g7vA
1g7uA Crystal structures of kdo8p synthase in its binary complex with substrate phosphoenol pyruvate (see paper)
46% identity, 96% coverage: 12:266/266 of query aligns to 19:275/284 of 1g7uA
1x6uA Kdo8p synthase in it's binary complex with the product kdo8p (see paper)
46% identity, 96% coverage: 12:266/266 of query aligns to 19:263/272 of 1x6uA
1phwA Crystal structure of kdo8p synthase in its binary complex with substrate analog 1-deoxy-a5p (see paper)
46% identity, 96% coverage: 12:266/266 of query aligns to 19:263/272 of 1phwA
1phqA Crystal structure of kdo8p synthase in its binary complex with substrate analog e-fpep
46% identity, 96% coverage: 12:266/266 of query aligns to 19:263/272 of 1phqA
1gg0A Crystal structure analysis of kdop synthase at 3.0 a (see paper)
46% identity, 96% coverage: 12:266/266 of query aligns to 19:266/275 of 1gg0A
4z1dA Structure of pep and zinc bound kdo8ps from h.Pylori (see paper)
44% identity, 94% coverage: 14:262/266 of query aligns to 4:253/256 of 4z1dA
>353847 FitnessBrowser__Btheta:353847
MIELKNNPAGNFFLLAGPCVIEGEEMAMRIAERVVGVTEKLQIPYVFKGSYRKANRSRLD
SFTGIGDEKALKVLKKVHDTFGVPTVTDIHSADEAEMAAEYVDILQIPAFLCRQTDLLVA
AAKTGKTINIKKGQFLSPLAMQFAADKVVEAGNKNVMLTERGTTFGYQDLVVDYRGIPEM
QTFGYPVILDVTHSLQQPNQTSGVTGGMPQLIETVAKAGIAVGADGIFIETHENPAVAKS
DGANMLKLDLLEGLLTKLVRIREAIK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory