Comparing 353949 FitnessBrowser__Btheta:353949 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P09099 Xylulose kinase; XK; Xylulokinase; 1-deoxy-D-xylulokinase; EC 2.7.1.17; EC 2.7.1.- from Escherichia coli (strain K12) (see paper)
32% identity, 98% coverage: 1:496/505 of query aligns to 1:482/484 of P09099
3ll3B The crystal structure of ligand bound xylulose kinase from lactobacillus acidophilus
27% identity, 99% coverage: 2:501/505 of query aligns to 3:490/490 of 3ll3B
2itmA Crystal structure of the e. Coli xylulose kinase complexed with xylulose (see paper)
31% identity, 98% coverage: 1:496/505 of query aligns to 1:474/476 of 2itmA
3ll3A The crystal structure of ligand bound xylulose kinase from lactobacillus acidophilus
26% identity, 99% coverage: 2:501/505 of query aligns to 4:492/492 of 3ll3A
5ya1A Crystal structure of lsrk-hpr complex with atp (see paper)
27% identity, 95% coverage: 2:480/505 of query aligns to 4:473/478 of 5ya1A
5ya2A Crystal structure of lsrk-hpr complex with adp (see paper)
27% identity, 95% coverage: 2:480/505 of query aligns to 4:473/478 of 5ya2A
3kzbA Crystal structure of xylulokinase from chromobacterium violaceum
29% identity, 84% coverage: 1:422/505 of query aligns to 4:423/498 of 3kzbA
6k76A Glycerol kinase form thermococcus kodakarensis, complex structure with substrate.
26% identity, 96% coverage: 3:489/505 of query aligns to 1:477/485 of 6k76A
O34154 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Enterococcus faecalis (strain ATCC 700802 / V583) (see 2 papers)
27% identity, 95% coverage: 2:482/505 of query aligns to 6:486/501 of O34154
Sites not aligning to the query:
3h3nX Glycerol kinase h232r with glycerol (see paper)
26% identity, 95% coverage: 2:482/505 of query aligns to 5:486/501 of 3h3nX
O34153 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Enterococcus casseliflavus (Enterococcus flavescens) (see 3 papers)
26% identity, 95% coverage: 2:482/505 of query aligns to 6:487/506 of O34153
P18157 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Bacillus subtilis (strain 168) (see paper)
24% identity, 97% coverage: 2:489/505 of query aligns to 4:492/496 of P18157
Q5HGD2 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Staphylococcus aureus (strain COL)
23% identity, 95% coverage: 2:482/505 of query aligns to 4:485/498 of Q5HGD2
3ge1A 2.7 angstrom crystal structure of glycerol kinase (glpk) from staphylococcus aureus in complex with adp and glycerol
23% identity, 95% coverage: 2:482/505 of query aligns to 5:486/499 of 3ge1A
O86033 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti)
24% identity, 90% coverage: 2:455/505 of query aligns to 4:456/497 of O86033
2w40A Crystal structure of plasmodium falciparum glycerol kinase with bound glycerol (see paper)
23% identity, 91% coverage: 3:464/505 of query aligns to 4:468/501 of 2w40A
2w41B Crystal structure of plasmodium falciparum glycerol kinase with adp (see paper)
23% identity, 91% coverage: 3:464/505 of query aligns to 10:474/507 of 2w41B
3i8bA The crystal structure of xylulose kinase from bifidobacterium adolescentis
26% identity, 87% coverage: 7:443/505 of query aligns to 10:465/506 of 3i8bA
3l0qA The crystal structure of xlylulose kinase from yersinia pseudotuberculosis
22% identity, 98% coverage: 2:497/505 of query aligns to 3:530/541 of 3l0qA
1bu6Y Crystal structures of escherichia coli glycerol kinase and the mutant a65t in an inactive tetramer: conformational changes and implications for allosteric regulation (see paper)
24% identity, 97% coverage: 2:489/505 of query aligns to 4:492/499 of 1bu6Y
>353949 FitnessBrowser__Btheta:353949
MYILAHDLGTSGNKATLFDESGLLIASRTAAYPTDYASGNRAEQNPHHWWKAIVDTTQAL
LELVSPNDIAGVALSGQMMGCLCIDKDGNPLRPHMLYCDQRSQEEEAKLTEKIDPLHFYE
ITGHRISASYSVEKLMWVKKHEPEIFAQTAKMLNAKDYINYRLCGTIATDPSDASGTNAY
DLNRWQWSEEIIEAAELDLSLFPEVRSSIDVIGEITNEAARETGLLAGTPVICGGGDGSC
AGVGVGCVAPGTAYNYLGSSSWVALTVEKPIVDEQRRTMNWAHVVPGMLHPSGTMQAAGS
SYNWMINQLCQNEQALAAQSGRSVFELIDEQIIASPIGANKLLFLPYMLGERTPRWNVDA
KGAFIGLTLGHKHGDMLRAVMEGVTLNLGFIINIFRKHVPIDRMTVIGGCAQNPVWRQMM
ADIYQAEIRVPNYLEEATSMGAAILAGIGAGVFPDFSVIDRFVRIEQTVQPIPENVKKYE
AWMPVFDQAYHALCEMYTEIAKTEL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory