Comparing 353951 FitnessBrowser__Btheta:353951 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 13 hits to proteins with known functional sites (download)
3ngjD Crystal structure of a putative deoxyribose-phosphate aldolase from entamoeba histolytica
50% identity, 89% coverage: 18:228/238 of query aligns to 10:218/222 of 3ngjD
Sites not aligning to the query:
Q4ZMV1 Deoxyribose-phosphate aldolase; DERA; 2-deoxy-D-ribose 5-phosphate aldolase; Phosphodeoxyriboaldolase; Deoxyriboaldolase; EC 4.1.2.4 from Pseudomonas syringae pv. syringae (strain B728a) (see paper)
51% identity, 91% coverage: 12:228/238 of query aligns to 3:217/226 of Q4ZMV1
1ub3A Crystal structure of tetrameric structure of aldolase from thermus thermophilus hb8 (see paper)
42% identity, 89% coverage: 18:228/238 of query aligns to 2:210/211 of 1ub3A
Q9Y315 Deoxyribose-phosphate aldolase; DERA; 2-deoxy-D-ribose 5-phosphate aldolase; Phosphodeoxyriboaldolase; Deoxyriboaldolase; EC 4.1.2.4 from Homo sapiens (Human) (see paper)
34% identity, 84% coverage: 21:220/238 of query aligns to 53:277/318 of Q9Y315
6z9iB Escherichia coli d-2-deoxyribose-5-phosphate aldolase - n21k mutant complex with reaction products (see paper)
33% identity, 77% coverage: 21:203/238 of query aligns to 12:205/248 of 6z9iB
Sites not aligning to the query:
5c2xB Crystal structure of deoxyribose-phosphate aldolase from colwellia psychrerythraea (tetragonal form) (see paper)
32% identity, 85% coverage: 20:221/238 of query aligns to 12:221/246 of 5c2xB
P0A6L0 Deoxyribose-phosphate aldolase; DERA; 2-deoxy-D-ribose 5-phosphate aldolase; Phosphodeoxyriboaldolase; Deoxyriboaldolase; EC 4.1.2.4 from Escherichia coli (strain K12) (see 2 papers)
32% identity, 77% coverage: 21:203/238 of query aligns to 14:207/259 of P0A6L0
Sites not aligning to the query:
7p76A Re-engineered 2-deoxy-d-ribose-5-phosphate aldolase catalysing asymmetric michael addition reactions, schiff base complex with cinnamaldehyde (see paper)
31% identity, 77% coverage: 21:203/238 of query aligns to 11:204/247 of 7p76A
5el1A Crystal structure of deoxyribose-phosphate aldolase from escherichia coli (k58e-y96w mutant) after acetaldehyde treatment (see paper)
32% identity, 77% coverage: 21:203/238 of query aligns to 12:205/248 of 5el1A
Sites not aligning to the query:
5ekyA Crystal structure of deoxyribose-phosphate aldolase from escherichia coli (k58e-y96w mutant) (see paper)
32% identity, 77% coverage: 21:203/238 of query aligns to 12:205/248 of 5ekyA
Sites not aligning to the query:
1jcjA Observation of covalent intermediates in an enzyme mechanism at atomic resolution (see paper)
32% identity, 77% coverage: 21:203/238 of query aligns to 15:208/252 of 1jcjA
Sites not aligning to the query:
3q2dA Optimization of the in silico designed kemp eliminase ke70 by computational design and directed evolution (see paper)
30% identity, 72% coverage: 32:203/238 of query aligns to 21:203/246 of 3q2dA
Sites not aligning to the query:
3qyqA 1.8 angstrom resolution crystal structure of a putative deoxyribose- phosphate aldolase from toxoplasma gondii me49 (see paper)
27% identity, 65% coverage: 32:186/238 of query aligns to 30:192/273 of 3qyqA
Sites not aligning to the query:
>353951 FitnessBrowser__Btheta:353951
MEKKNINEVIANLSVEQLAGMIDHTFLKPFGTAENIEKLCAEARQYQFAMVAINPAEVET
CVKLLEGSGVRVGAAIGFPLGQNTVECKAFETRDAIAKGATEIDTVINVRALQKGQTDIV
KKEIEDMVSICKPAGVICKVILETCYLTDEEKETVCRIAKEAGVDFVKTSTGFGTAGANV
HDVALMRRVVGPVIGVKAAGGIRDLDTALALIQVGATRIGTSSGIQIVEAYKELKKGL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory