Comparing 353974 FitnessBrowser__Btheta:353974 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 18 hits to proteins with known functional sites (download)
3ec7A Crystal structure of putative dehydrogenase from salmonella typhimurium lt2
29% identity, 29% coverage: 41:182/491 of query aligns to 3:147/336 of 3ec7A
Sites not aligning to the query:
7d5nB Crystal structure of inositol dehydrogenase homolog complexed with nadh and myo-inositol from azotobacter vinelandii
27% identity, 28% coverage: 48:186/491 of query aligns to 16:167/389 of 7d5nB
Sites not aligning to the query:
7d5mA Crystal structure of inositol dehydrogenase homolog complexed with NAD+ from azotobacter vinelandii
27% identity, 28% coverage: 48:186/491 of query aligns to 17:168/389 of 7d5mA
Sites not aligning to the query:
7d5nA Crystal structure of inositol dehydrogenase homolog complexed with nadh and myo-inositol from azotobacter vinelandii
27% identity, 28% coverage: 48:186/491 of query aligns to 16:167/379 of 7d5nA
Sites not aligning to the query:
3dtyA Crystal structure of an oxidoreductase from pseudomonas syringae
28% identity, 28% coverage: 48:186/491 of query aligns to 12:163/374 of 3dtyA
Sites not aligning to the query:
7xreC Crystal structure of dgpa
28% identity, 24% coverage: 65:183/491 of query aligns to 33:151/363 of 7xreC
Sites not aligning to the query:
3e18A Crystal structure of NAD-binding protein from listeria innocua
29% identity, 20% coverage: 40:136/491 of query aligns to 3:97/348 of 3e18A
Sites not aligning to the query:
6t2bB Glycoside hydrolase family 109 from akkermansia muciniphila in complex with galnac and NAD+.
26% identity, 31% coverage: 40:189/491 of query aligns to 33:191/439 of 6t2bB
Sites not aligning to the query:
7xr9A Crystal structure of dgpa with glucose (see paper)
27% identity, 26% coverage: 54:183/491 of query aligns to 16:141/344 of 7xr9A
Sites not aligning to the query:
6a3iA Levoglucosan dehydrogenase, complex with nadh and levoglucosan (see paper)
26% identity, 33% coverage: 91:254/491 of query aligns to 63:194/372 of 6a3iA
Sites not aligning to the query:
6a3jC Levoglucosan dehydrogenase, complex with nadh and l-sorbose (see paper)
26% identity, 33% coverage: 91:254/491 of query aligns to 62:193/378 of 6a3jC
Sites not aligning to the query:
F0M433 Levoglucosan dehydrogenase; LGDH; 1,6-anhydro-beta-D-glucose dehydrogenase; PpLGDH; EC 1.1.1.425 from Pseudarthrobacter phenanthrenivorans (strain DSM 18606 / JCM 16027 / LMG 23796 / Sphe3) (Arthrobacter phenanthrenivorans) (see paper)
26% identity, 33% coverage: 91:254/491 of query aligns to 64:195/390 of F0M433
Sites not aligning to the query:
3ceaA Crystal structure of myo-inositol 2-dehydrogenase (np_786804.1) from lactobacillus plantarum at 2.40 a resolution
26% identity, 29% coverage: 41:183/491 of query aligns to 5:149/342 of 3ceaA
Sites not aligning to the query:
1evjA Crystal structure of glucose-fructose oxidoreductase (gfor) delta1-22 s64d (see paper)
30% identity, 24% coverage: 41:159/491 of query aligns to 15:126/340 of 1evjA
Sites not aligning to the query:
3nt5A Crystal structure of myo-inositol dehydrogenase from bacillus subtilis with bound cofactor and product inosose (see paper)
27% identity, 31% coverage: 41:193/491 of query aligns to 3:158/337 of 3nt5A
Sites not aligning to the query:
3nt4A Crystal structure of myo-inositol dehydrogenase from bacillus subtilis with bound cofactor nadh and inositol (see paper)
27% identity, 31% coverage: 41:193/491 of query aligns to 3:158/337 of 3nt4A
Sites not aligning to the query:
3nt2B Crystal structure of myo-inositol dehydrogenase from bacillus subtilis with bound cofactor (see paper)
27% identity, 31% coverage: 41:193/491 of query aligns to 3:158/337 of 3nt2B
Sites not aligning to the query:
3nt2A Crystal structure of myo-inositol dehydrogenase from bacillus subtilis with bound cofactor (see paper)
27% identity, 31% coverage: 41:193/491 of query aligns to 3:158/337 of 3nt2A
Sites not aligning to the query:
>353974 FitnessBrowser__Btheta:353974
MSDFSRRKFLKTGAAALAGITIAPSSILGMSHGHVSPTDKLNLAAVGIGGMGHANINNVK
GTENIVALCDVDWKYAKGVFDEFPNAKKYWDYRKMYDEMGKSIDGVIIATADHTHAIITA
DAMTMGKHVYCQKPLTHSVYESRLLTNLAASTGVVTQMGNQGASGEGTDLVCEWIWNGEI
GEVTKVECATDRPIWPQGLNAPEKADRIPNTLNWDLFTGPAKLNPYNNVYHPWNWRGWWD
YGTGALGDMACHILHQPFRALKLGYPTKVEGSSTLLLSACAPQAQHVKMIFPARDNMPKV
ALPEVEVHWYDGGMMPERPKGFPEGKQLMGPGGGLTIFHGTKDTLICGCYGEQPFLLSGR
VPNAPKVCRRVTCSHEMDWVRACKEDKSNRVMPKADFSESGPMNEMVVMGVLAIRLQGLN
KTLEWDGANMCFTNIGDNETLRTCIKDGFTIHDGHPSFNKTWTDPINAKQFAAELVKHNY
REGWNLPDMPR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory