SitesBLAST
Comparing 354190 FitnessBrowser__Btheta:354190 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6hulB Sulfolobus solfataricus tryptophan synthase ab complex (see paper)
47% identity, 92% coverage: 12:430/456 of query aligns to 1:414/416 of 6hulB
- binding pyridoxal-5'-phosphate: H103 (= H114), K104 (= K115), Q131 (= Q142), S220 (= S232), G255 (= G267), G256 (= G268), G257 (= G269), S258 (= S270), N259 (= N271), E371 (= E387), S400 (= S416), G401 (= G417)
- binding serine: K104 (= K115), T127 (= T138), G128 (= G139), A129 (= A140), G130 (= G141), W132 (= W143)
4qysB Trpb2 enzymes (see paper)
42% identity, 93% coverage: 5:430/456 of query aligns to 1:416/418 of 4qysB
- active site: K101 (= K115), E123 (= E137), S402 (= S416)
- binding (5-hydroxy-4,6-dimethylpyridin-3-yl)methyl dihydrogen phosphate: H100 (= H114), K101 (= K115), G252 (= G267), G253 (= G268), G254 (= G269), S255 (= S270), N256 (= N271), E373 (= E387), S402 (= S416)
4qysA Trpb2 enzymes (see paper)
41% identity, 93% coverage: 5:430/456 of query aligns to 1:406/408 of 4qysA
- active site: K108 (= K115), E130 (= E137), S392 (= S416)
- binding pyridoxal-5'-phosphate: H107 (= H114), K108 (= K115), G242 (= G267), G243 (= G268), G244 (= G269), S245 (= S270), N246 (= N271), E363 (= E387), S392 (= S416)
- binding phosphoserine: K108 (= K115), G132 (= G139), A133 (= A140), Q135 (= Q142), W136 (= W143), G316 (= G340), R318 (= R342), E363 (= E387)
5ey5B Lbcats
34% identity, 75% coverage: 81:423/456 of query aligns to 49:378/383 of 5ey5B
- binding pyridoxal-5'-phosphate: H81 (= H114), K82 (= K115), Q109 (= Q142), S185 (= S232), G227 (= G267), G229 (= G269), S230 (= S270), N231 (= N271), E345 (= E387), S371 (= S416), G372 (= G417)
5t6mA Structure of the tryptophan synthase b-subunit from pyroccus furiosus with b-methyltryptophan non-covalently bound (see paper)
32% identity, 80% coverage: 58:423/456 of query aligns to 20:376/383 of 5t6mA
5ixjD Tryptophan synthase beta-subunit from pyrococcus furiosus with l- threonine non-covalently bound in the active site (see paper)
32% identity, 80% coverage: 58:423/456 of query aligns to 20:376/394 of 5ixjD
5vm5D Engineered tryptophan synthase b-subunit from pyrococcus furiosus, pftrpb2b9, with ser bound (see paper)
32% identity, 80% coverage: 58:423/456 of query aligns to 20:376/383 of 5vm5D
- active site: K82 (= K115), E104 (= E137), S369 (= S416)
- binding 2-{[(E)-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene]amino}prop-2-enoic acid: H81 (= H114), K82 (= K115), T105 (= T138), G106 (= G139), A107 (= A140), Q109 (= Q142), H110 (≠ W143), S185 (= S232), G227 (= G267), G229 (= G269), S230 (= S270), N231 (= N271), G296 (= G340), E343 (= E387), S369 (= S416)
6cutA Engineered holo trpb from pyrococcus furiosus, pftrpb7e6 with (2s,3s)- isopropylserine bound as the external aldimine (see paper)
33% identity, 80% coverage: 58:423/456 of query aligns to 20:378/385 of 6cutA
- binding (2S,3S)-3-hydroxy-2-[(E)-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene)amino]-4-methylpentanoic acid (non-preferred name): H81 (= H114), K82 (= K115), T105 (= T138), G106 (= G139), A107 (= A140), Q109 (= Q142), H110 (≠ W143), S185 (= S232), G227 (= G267), G229 (= G269), S230 (= S270), N231 (= N271), G298 (= G340), E345 (= E387), S371 (= S416)
6cuzA Engineered trpb from pyrococcus furiosus, pftrpb7e6 with (2s,3r)- ethylserine bound as the amino-acrylate (see paper)
33% identity, 80% coverage: 58:423/456 of query aligns to 20:378/383 of 6cuzA
- binding (2E)-2-[(E)-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene)amino]pent-2-enoic acid: H81 (= H114), K82 (= K115), T105 (= T138), G106 (= G139), A107 (= A140), Q109 (= Q142), H110 (≠ W143), S185 (= S232), G227 (= G267), G229 (= G269), S230 (= S270), N231 (= N271), G298 (= G340), E345 (= E387), S371 (= S416)
5dw3A Tryptophan synthase beta-subunit from pyrococcus furiosus with product l-tryptophan non-covalently bound in the active site (see paper)
32% identity, 80% coverage: 58:423/456 of query aligns to 20:377/383 of 5dw3A
- active site: K82 (= K115), E104 (= E137), S370 (= S416)
- binding tryptophan: K82 (= K115), E104 (= E137), T105 (= T138), G106 (= G139), A107 (= A140), Q109 (= Q142), H110 (≠ W143), S185 (= S232), G228 (= G268), Y300 (= Y343)
5t6mB Structure of the tryptophan synthase b-subunit from pyroccus furiosus with b-methyltryptophan non-covalently bound (see paper)
32% identity, 80% coverage: 58:423/456 of query aligns to 20:378/386 of 5t6mB
1v8zA X-ray crystal structure of the tryptophan synthase b2 subunit from hyperthermophile, pyrococcus furiosus (see paper)
32% identity, 80% coverage: 58:423/456 of query aligns to 20:378/386 of 1v8zA
- active site: K82 (= K115), E104 (= E137), S371 (= S416)
- binding pyridoxal-5'-phosphate: H81 (= H114), K82 (= K115), Q109 (= Q142), S185 (= S232), G227 (= G267), G228 (= G268), G229 (= G269), S230 (= S270), N231 (= N271), E345 (= E387), S371 (= S416), G372 (= G417)
5dw0A Trpb from pyrococcus furiosus with l-serine bound as the external aldimine (see paper)
32% identity, 80% coverage: 58:423/456 of query aligns to 20:378/388 of 5dw0A
- active site: K82 (= K115), E104 (= E137), S371 (= S416)
- binding [3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl]-serine: H81 (= H114), K82 (= K115), T105 (= T138), G106 (= G139), A107 (= A140), Q109 (= Q142), H110 (≠ W143), S185 (= S232), G227 (= G267), G229 (= G269), S230 (= S270), N231 (= N271), G298 (= G340), D300 (≠ R342), E345 (= E387), S371 (= S416)
6am8B Engineered tryptophan synthase b-subunit from pyrococcus furiosus, pftrpb2b9 with trp bound as e(aex2) (see paper)
31% identity, 80% coverage: 58:423/456 of query aligns to 20:378/385 of 6am8B
- active site: K82 (= K115), E104 (= E137), S371 (= S416)
- binding [3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl]-l-tryptophane: H81 (= H114), K82 (= K115), E104 (= E137), T105 (= T138), G106 (= G139), A107 (= A140), Q109 (= Q142), H110 (≠ W143), L161 (= L209), S185 (= S232), V187 (≠ L234), G227 (= G267), G228 (= G268), G229 (= G269), S230 (= S270), N231 (= N271), G298 (= G340), Y301 (= Y343), E345 (= E387), S371 (= S416), G372 (= G417)
- binding tryptophan: L169 (≠ I217), S274 (≠ T304), H275 (≠ R305)
Sites not aligning to the query:
7rnpA Engineered tryptophan synthase b-subunit from pyrococcus furiosus, pftrpb2b9_h275e with 4-cl-trp non-covalently bound (see paper)
32% identity, 80% coverage: 58:423/456 of query aligns to 20:378/384 of 7rnpA
6usaB Crystal structure of tryptophan synthase from m. Tuberculosis - aminoacrylate- and gsk1-bound form (see paper)
31% identity, 79% coverage: 71:430/456 of query aligns to 52:400/404 of 6usaB
- active site: K97 (= K115), E119 (= E137), S386 (= S416)
- binding 2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]acrylic acid: H96 (= H114), K97 (= K115), T120 (= T138), G121 (= G139), A122 (= A140), G123 (= G141), Q124 (= Q142), H125 (≠ W143), T200 (≠ S232), G242 (= G267), G244 (= G269), S245 (= S270), N246 (= N271), G313 (= G340), E360 (= E387), S386 (= S416)
- binding (3R,4R)-4-[4-(2-Chlorophenyl)piperazin-1-yl]-1,1-dioxothiolan-3-ol: F184 (≠ I217), W187 (≠ L219), Y196 (= Y228), F198 (≠ L230), G203 (vs. gap), P204 (vs. gap), F207 (vs. gap), H290 (≠ R305), G291 (= G306)
6dweB Crystal structure of tryptophan synthase from m. Tuberculosis - aminoacrylate- and brd0059-bound form
31% identity, 79% coverage: 71:430/456 of query aligns to 52:400/404 of 6dweB
- active site: K97 (= K115), E119 (= E137), S386 (= S416)
- binding (2R,3S,4R)-3-(2',6'-difluoro-4'-methyl[1,1'-biphenyl]-4-yl)-4-(fluoromethyl)azetidine-2-carbonitrile: F184 (≠ I217), Y196 (= Y228), F198 (≠ L230), P204 (vs. gap), F207 (vs. gap), H290 (≠ R305)
- binding 2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]acrylic acid: H96 (= H114), K97 (= K115), T120 (= T138), G121 (= G139), A122 (= A140), G123 (= G141), Q124 (= Q142), H125 (≠ W143), T200 (≠ S232), G242 (= G267), G244 (= G269), S245 (= S270), N246 (= N271), G313 (= G340), E360 (= E387), S386 (= S416)
6uapB Crystal structure of tryptophan synthase from m. Tuberculosis - open form with brd6309 bound
31% identity, 79% coverage: 71:430/456 of query aligns to 52:400/405 of 6uapB
- active site: K97 (= K115), E119 (= E137), S386 (= S416)
- binding (2R,3S,4R)-3-(4'-chloro-2',6'-difluoro[1,1'-biphenyl]-4-yl)-4-(fluoromethyl)azetidine-2-carbonitrile: I180 (= I213), N181 (≠ S214), F184 (≠ I217), Y196 (= Y228), F198 (≠ L230), P204 (vs. gap), F207 (vs. gap), H290 (≠ R305)
5tciH Crystal structure of tryptophan synthase from m. Tuberculosis - brd4592-bound form (see paper)
31% identity, 79% coverage: 71:430/456 of query aligns to 53:401/406 of 5tciH
Sites not aligning to the query:
6u6cB Crystal structure of tryptophan synthase from m. Tuberculosis - aminoacrylate- and gsk2-bound form (see paper)
31% identity, 79% coverage: 71:430/456 of query aligns to 53:401/405 of 6u6cB
- active site: K98 (= K115), E120 (= E137), S387 (= S416)
- binding 2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]acrylic acid: H97 (= H114), K98 (= K115), T121 (= T138), G122 (= G139), A123 (= A140), Q125 (= Q142), H126 (≠ W143), T201 (≠ S232), G243 (= G267), G245 (= G269), S246 (= S270), N247 (= N271), G314 (= G340), E361 (= E387), S387 (= S416)
- binding 1-(2-fluorobenzene-1-carbonyl)-N-methyl-2,3-dihydro-1H-indole-5-sulfonamide: F185 (≠ I217), W188 (≠ L219), Y197 (= Y228), F199 (≠ L230), G204 (vs. gap), P205 (vs. gap), H291 (≠ R305), G292 (= G306)
Sites not aligning to the query:
Query Sequence
>354190 FitnessBrowser__Btheta:354190
MSDKRKRYILPEEEIPHYWYNIQADMVNKPMPPLHPGTKQPLKAEDLYPIFAKELCHQEL
NQTDAWIEIPEDVREMYKYYRSTPLVRAYGLEKALGTPAHIYFKNESVSPIGSHKLNSAL
AQAYYCKEEGVTNVTTETGAGQWGAALSYAAKVFGLEAAVYQVKISYEQKPYRRSIMQTF
GAQVTPSPSMSTRAGKDILTAHPTYQGSLGTAISEAIELAQMTPNCKYTLGSVLSHVTLH
QTIIGLEAEKQMEMAGEYPDVVIGCFGGGSNFGGISFPFMRHNILEGKKTRFVAAEPASC
PKLTRGKFQYDFGDEAGYTPLLPMFTLGHNFAPAHIHAGGLRYHGAGVIVSQLLKDNLME
AVDIQQLESFEAGCLFAQAEGIIPAPESSHAIAAAIREAKACKETGEEKVILFNLSGHGL
IDMASYDKYLAGDLVNYALTDEDIQKNLDEIGDLSK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory