SitesBLAST
Comparing 3606714 FitnessBrowser__Dino:3606714 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2ay9A Aromatic amino acid aminotransferase with 5-phenylvaleric acid (see paper)
45% identity, 99% coverage: 1:389/392 of query aligns to 1:392/394 of 2ay9A
- active site: W127 (= W125), D208 (= D206), A210 (= A208), K243 (= K240)
- binding 5-phenylvaleric acid: Y65 (= Y65), W127 (= W125), N129 (= N127), N180 (= N178), S281 (= S278), F282 (= F279), R371 (= R368)
- binding pyridoxal-5'-phosphate: G99 (= G97), G100 (= G98), T101 (= T99), W127 (= W125), N180 (= N178), D208 (= D206), A210 (= A208), Y211 (= Y209), S240 (= S237), S242 (= S239), K243 (= K240), R251 (= R248)
2ay8A Aromatic amino acid aminotransferase with 4-(2-thienyl)butyric acid (see paper)
45% identity, 99% coverage: 1:389/392 of query aligns to 1:392/394 of 2ay8A
- active site: W127 (= W125), D208 (= D206), A210 (= A208), K243 (= K240)
- binding 4-(2-thienyl)butyric acid: G34 (= G34), Y65 (= Y65), W127 (= W125), N180 (= N178), S281 (= S278), F282 (= F279), F345 (= F342), R371 (= R368)
- binding pyridoxal-5'-phosphate: G100 (= G98), T101 (= T99), W127 (= W125), N180 (= N178), D208 (= D206), A210 (= A208), Y211 (= Y209), S240 (= S237), S242 (= S239), K243 (= K240), R251 (= R248)
2ay7A Aromatic amino acid aminotransferase with 4-phenylbutyric acid (see paper)
45% identity, 99% coverage: 1:389/392 of query aligns to 1:392/394 of 2ay7A
- active site: W127 (= W125), D208 (= D206), A210 (= A208), K243 (= K240)
- binding 4-phenyl-butanoic acid: Y65 (= Y65), S281 (= S278)
- binding pyridoxal-5'-phosphate: G99 (= G97), G100 (= G98), T101 (= T99), W127 (= W125), D208 (= D206), A210 (= A208), Y211 (= Y209), S240 (= S237), S242 (= S239), K243 (= K240), R251 (= R248)
2ay6A Aromatic amino acid aminotransferase with 3-indolebutyric acid (see paper)
45% identity, 99% coverage: 1:389/392 of query aligns to 1:392/394 of 2ay6A
- active site: W127 (= W125), D208 (= D206), A210 (= A208), K243 (= K240)
- binding 3-indolebutyric acid: Y65 (= Y65), S281 (= S278)
- binding pyridoxal-5'-phosphate: G99 (= G97), G100 (= G98), T101 (= T99), W127 (= W125), N180 (= N178), D208 (= D206), A210 (= A208), Y211 (= Y209), S240 (= S237), S242 (= S239), K243 (= K240), R251 (= R248)
2ay5A Aromatic amino acid aminotransferase with 3-indolepropionic acid (see paper)
45% identity, 99% coverage: 1:389/392 of query aligns to 1:392/394 of 2ay5A
- active site: W127 (= W125), D208 (= D206), A210 (= A208), K243 (= K240)
- binding indolylpropionic acid: Y65 (= Y65), S281 (= S278)
- binding pyridoxal-5'-phosphate: G99 (= G97), G100 (= G98), T101 (= T99), W127 (= W125), N180 (= N178), D208 (= D206), A210 (= A208), Y211 (= Y209), S240 (= S237), S242 (= S239), K243 (= K240), R251 (= R248)
2ay3A Aromatic amino acid aminotransferase with 3-(3,4-dimethoxyphenyl) propionic acid (see paper)
45% identity, 99% coverage: 1:389/392 of query aligns to 1:392/394 of 2ay3A
- active site: W127 (= W125), D208 (= D206), A210 (= A208), K243 (= K240)
- binding 3-(3,4-dimethoxyphenyl)propionic acid: G34 (= G34), W127 (= W125), N129 (= N127), N180 (= N178), R371 (= R368)
- binding pyridoxal-5'-phosphate: G99 (= G97), G100 (= G98), T101 (= T99), W127 (= W125), N180 (= N178), D208 (= D206), A210 (= A208), Y211 (= Y209), S240 (= S237), S242 (= S239), K243 (= K240), R251 (= R248)
2ay1A Aromatic amino acid aminotransferase with 4-aminohydrocinnamic acid (see paper)
45% identity, 99% coverage: 1:389/392 of query aligns to 1:392/394 of 2ay1A
- active site: W127 (= W125), D208 (= D206), A210 (= A208), K243 (= K240)
- binding 4-aminohydrocinnamic acid: Y65 (= Y65), S281 (= S278)
- binding pyridoxal-5'-phosphate: G100 (= G98), T101 (= T99), W127 (= W125), N180 (= N178), D208 (= D206), A210 (= A208), Y211 (= Y209), S240 (= S237), S242 (= S239), K243 (= K240), R251 (= R248)
1ay4A Aromatic amino acid aminotransferase without substrate (see paper)
45% identity, 99% coverage: 1:389/392 of query aligns to 1:392/394 of 1ay4A
- active site: W127 (= W125), D208 (= D206), A210 (= A208), K243 (= K240)
- binding pyridoxal-5'-phosphate: G100 (= G98), T101 (= T99), W127 (= W125), D208 (= D206), A210 (= A208), Y211 (= Y209), S240 (= S237), S242 (= S239), K243 (= K240), R251 (= R248)
2ay4B Aromatic amino acid aminotransferase with 3-(p-tolyl)propionic acid (see paper)
44% identity, 99% coverage: 1:389/392 of query aligns to 1:386/388 of 2ay4B
- active site: W121 (= W125), D202 (= D206), A204 (= A208), K237 (= K240)
- binding pyridoxal-5'-phosphate: G94 (= G98), T95 (= T99), W121 (= W125), N174 (= N178), D202 (= D206), A204 (= A208), Y205 (= Y209), S234 (= S237), S236 (= S239), K237 (= K240), R245 (= R248)
- binding 3-(p-tolyl)propionic acid: I13 (= I13), G28 (= G34), W121 (= W125), N123 (= N127), R365 (= R368)
2ay2B Aromatic amino acid aminotransferase with cyclohexane propionic acid (see paper)
44% identity, 99% coverage: 1:389/392 of query aligns to 1:386/388 of 2ay2B
- active site: W121 (= W125), D202 (= D206), A204 (= A208), K237 (= K240)
- binding cyclohexane propionic acid: G28 (= G34), W121 (= W125), R365 (= R368)
- binding pyridoxal-5'-phosphate: G94 (= G98), T95 (= T99), W121 (= W125), N174 (= N178), D202 (= D206), A204 (= A208), Y205 (= Y209), S234 (= S237), S236 (= S239), K237 (= K240), R245 (= R248)
1ay8B Aromatic amino acid aminotransferase complex with 3-phenylpropionate (see paper)
44% identity, 99% coverage: 1:389/392 of query aligns to 1:386/388 of 1ay8B
- active site: W121 (= W125), D202 (= D206), A204 (= A208), K237 (= K240)
- binding hydrocinnamic acid: V27 (≠ I33), G28 (= G34), W121 (= W125), N123 (= N127), R365 (= R368)
- binding pyridoxal-5'-phosphate: G94 (= G98), T95 (= T99), W121 (= W125), N174 (= N178), D202 (= D206), A204 (= A208), Y205 (= Y209), S234 (= S237), S236 (= S239), K237 (= K240), R245 (= R248)
5vwrA E.Coli aspartate aminotransferase-(1r,3s,4s)-3-amino-4- fluorocyclopentane-1-carboxylic acid (fcp)-alpha-ketoglutarate (see paper)
42% identity, 99% coverage: 1:390/392 of query aligns to 1:396/396 of 5vwrA
- active site: W130 (= W125), D211 (= D206), A213 (= A208), K246 (= K240)
- binding (E)-N-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene)-L-glutamic acid: I13 (= I13), G34 (= G34), G102 (= G97), G103 (= G98), T104 (= T99), W130 (= W125), N183 (= N178), D211 (= D206), Y214 (= Y209), S243 (= S237), S245 (= S239), K246 (= K240), R254 (= R248), R374 (= R368)
5t4lA Plp and gaba trigger gabr-mediated transcription regulation in bacillus subsidies via external aldimine formation (see paper)
42% identity, 99% coverage: 1:390/392 of query aligns to 1:396/396 of 5t4lA
- active site: W130 (= W125), D211 (= D206), A213 (= A208), K246 (= K240)
- binding (4R)-4-amino-6-{3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}hexanoic acid: G102 (= G97), G103 (= G98), T104 (= T99), W130 (= W125), D211 (= D206), Y214 (= Y209), S243 (= S237), S245 (= S239), K246 (= K240), R254 (= R248)
3qpgA Crystal structures of escherichia coli aspartate aminotransferase reconstituted with 1-deaza-pyridoxal 5'-phosphate: internal aldimine and stable l-aspartate external aldimine (see paper)
42% identity, 99% coverage: 1:390/392 of query aligns to 1:396/396 of 3qpgA
- active site: W130 (= W125), D211 (= D206), A213 (= A208), K246 (= K240)
- binding (E)-N-{2-hydroxy-3-methyl-6-[(phosphonooxy)methyl]benzylidene}-L-aspartic acid: I13 (= I13), G34 (= G34), G102 (= G97), G103 (= G98), T104 (= T99), W130 (= W125), N183 (= N178), D211 (= D206), Y214 (= Y209), S243 (= S237), S245 (= S239), K246 (= K240), R254 (= R248), R374 (= R368)
3pa9A Mechanism of inactivation of e. Coli aspartate aminotransferase by (s)-4-amino-4,5-dihydro-2-furancarboxylic acid (s-adfa) ph 7.5 (see paper)
42% identity, 99% coverage: 1:390/392 of query aligns to 1:396/396 of 3pa9A
- active site: W130 (= W125), D211 (= D206), A213 (= A208), K246 (= K240)
- binding 4-aminofuran-2-carboxylic acid: G34 (= G34), W130 (= W125), K246 (= K240), F348 (= F342), R374 (= R368)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G103 (= G98), T104 (= T99), W130 (= W125), D211 (= D206), A213 (= A208), Y214 (= Y209), S243 (= S237), S245 (= S239), K246 (= K240), R254 (= R248)
1x2aA Crystal structure of e.Coli aspat complexed with n-phosphopyridoxyl-d- glutamic acid (see paper)
42% identity, 99% coverage: 1:390/392 of query aligns to 1:396/396 of 1x2aA
- active site: W130 (= W125), D211 (= D206), A213 (= A208), K246 (= K240)
- binding n-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)-d-glutamic acid: I33 (= I33), G34 (= G34), Y65 (= Y65), G102 (= G97), G103 (= G98), T104 (= T99), W130 (= W125), N183 (= N178), D211 (= D206), Y214 (= Y209), S243 (= S237), S245 (= S239), K246 (= K240), R254 (= R248), R280 (= R274), F348 (= F342), R374 (= R368)
1x29A Crystal structure of e.Coli aspat complexed with n-phosphopyridoxyl-2- methyl-l-glutamic acid (see paper)
42% identity, 99% coverage: 1:390/392 of query aligns to 1:396/396 of 1x29A
- active site: W130 (= W125), D211 (= D206), A213 (= A208), K246 (= K240)
- binding n-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)-2-methyl-l-glutamic acid: I13 (= I13), G34 (= G34), Y65 (= Y65), G103 (= G98), T104 (= T99), W130 (= W125), N183 (= N178), D211 (= D206), Y214 (= Y209), S243 (= S237), S245 (= S239), K246 (= K240), R254 (= R248), R280 (= R274), F348 (= F342), R374 (= R368)
1x28A Crystal structure of e.Coli aspat complexed with n-phosphopyridoxyl-l- glutamic acid (see paper)
42% identity, 99% coverage: 1:390/392 of query aligns to 1:396/396 of 1x28A
- active site: W130 (= W125), D211 (= D206), A213 (= A208), K246 (= K240)
- binding N-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)-L-glutamic acid: I13 (= I13), Y65 (= Y65), G103 (= G98), T104 (= T99), W130 (= W125), N183 (= N178), D211 (= D206), Y214 (= Y209), S243 (= S237), S245 (= S239), K246 (= K240), R254 (= R248), R280 (= R274), F348 (= F342), R374 (= R368)
1cq8A Aspartate aminotransferase (E.C. 2.6.1.1) complexed with c6-pyridoxal- 5p-phosphate (see paper)
42% identity, 99% coverage: 1:390/392 of query aligns to 1:396/396 of 1cq8A
- active site: W130 (= W125), D211 (= D206), A213 (= A208), K246 (= K240)
- binding 2-[o-phosphonopyridoxyl]-amino-hexanoic acid: I33 (= I33), G34 (= G34), G103 (= G98), T104 (= T99), W130 (= W125), N183 (= N178), D211 (= D206), A213 (= A208), Y214 (= Y209), S243 (= S237), S245 (= S239), K246 (= K240), R254 (= R248), R374 (= R368)
1cq7A Aspartate aminotransferase (E.C. 2.6.1.1) complexed with c5-pyridoxal- 5p-phosphate (see paper)
42% identity, 99% coverage: 1:390/392 of query aligns to 1:396/396 of 1cq7A
- active site: W130 (= W125), D211 (= D206), A213 (= A208), K246 (= K240)
- binding 2-[o-phosphonopyridoxyl]-amino-pentanoic acid: I13 (= I13), I33 (= I33), G34 (= G34), G103 (= G98), T104 (= T99), W130 (= W125), N183 (= N178), D211 (= D206), Y214 (= Y209), S243 (= S237), S245 (= S239), K246 (= K240), R254 (= R248), R374 (= R368)
Query Sequence
>3606714 FitnessBrowser__Dino:3606714
MFAHLRPQADDPILVLMRAFQADPRPGKVDLGIGVWRDAEGRTPVFGAVKTAEERLWRTQ
DTKSYVSFAGDPAFHAAVGDLLLGSVTRPRAVTATTGGTSAVQTLLALSQVARPAAQVWI
PAETWPNHRVLAEHLGLATRAFTYLAPEGTGIDREVLLRDLAQAQAGDVVILHACCHNPT
GIDPDPELQAEIVDSLARTGAVPLVDCAYLGFGAVPEADAAFLRRLASLPEAMLAFSGSK
SFGLYRERVGLALVLLEQPGVVEAVQSQLTRLNRVNYSFPPDHGARVVTEILADPALRTA
WEAELAAIRTALSANRQALAKALRARLQSDRFDGLAAQSGMFAMLPLGKERVMRMREDFA
VYAVGTGRVNLAGVTPRTTDRVAEAIAAVLRD
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory