Comparing 3606783 Dshi_0214 3-hydroxybutyryl-CoA dehydrogenase (RefSeq) to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6aa8E Crystal structure of (s)-3-hydroxybutyryl-coenzymea dehydrogenase from clostridium acetobutylicum complexed with NAD+ (see paper)
55% identity, 96% coverage: 4:282/291 of query aligns to 1:279/281 of 6aa8E
4kuhA Crystal structure of 3-hydroxybutylryl-coa dehydrogenase with acetoacetyl-coa from clostridium butyricum
52% identity, 96% coverage: 3:282/291 of query aligns to 1:280/280 of 4kuhA
4kugA Crystal structure of 3-hydroxybutylryl-coa dehydrogenase with NAD from clostridium butyricum
52% identity, 96% coverage: 3:282/291 of query aligns to 1:280/282 of 4kugA
4pzeA Crystal structure of (s)-3-hydroxybutyryl-coa dehydrogenase paah1 in complex with acetoacetyl-coa (see paper)
51% identity, 96% coverage: 3:282/291 of query aligns to 2:281/283 of 4pzeA
4pzdA Crystal structure of (s)-3-hydroxybutyryl-coa dehydrogenase paah1 in complex with NAD+ (see paper)
51% identity, 96% coverage: 3:282/291 of query aligns to 2:281/283 of 4pzdA
P9WNP7 3-hydroxybutyryl-CoA dehydrogenase; Beta-hydroxybutyryl-CoA dehydrogenase; BHBD; EC 1.1.1.157 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
42% identity, 96% coverage: 3:282/291 of query aligns to 5:286/286 of P9WNP7
1f17A L-3-hydroxyacyl-coa dehydrogenase complexed with nadh (see paper)
41% identity, 97% coverage: 3:285/291 of query aligns to 4:293/293 of 1f17A
1f12A L-3-hydroxyacyl-coa dehydrogenase complexed with 3-hydroxybutyryl-coa (see paper)
41% identity, 97% coverage: 3:285/291 of query aligns to 4:293/293 of 1f12A
1f0yA L-3-hydroxyacyl-coa dehydrogenase complexed with acetoacetyl-coa and NAD+ (see paper)
41% identity, 97% coverage: 3:283/291 of query aligns to 4:291/291 of 1f0yA
Q16836 Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial; HCDH; Medium and short-chain L-3-hydroxyacyl-coenzyme A dehydrogenase; Short-chain 3-hydroxyacyl-CoA dehydrogenase; EC 1.1.1.35 from Homo sapiens (Human) (see 7 papers)
41% identity, 97% coverage: 3:283/291 of query aligns to 27:314/314 of Q16836
P00348 Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial; HCDH; L-3-hydroxyacyl CoA dehydrogenase; Medium and short-chain L-3-hydroxyacyl-coenzyme A dehydrogenase; Short-chain 3-hydroxyacyl-CoA dehydrogenase; EC 1.1.1.35 from Sus scrofa (Pig) (see paper)
41% identity, 97% coverage: 3:283/291 of query aligns to 27:314/314 of P00348
6iunB Crystal structure of enoyl-coa hydratase (ech) from ralstonia eutropha h16 in complex with NAD
36% identity, 97% coverage: 3:283/291 of query aligns to 291:567/692 of 6iunB
Sites not aligning to the query:
1wdmA Fatty acid beta-oxidation multienzyme complex from pseudomonas fragi, form i (native3) (see paper)
37% identity, 97% coverage: 2:283/291 of query aligns to 313:593/707 of 1wdmA
Sites not aligning to the query:
7o4uA Structure of the alpha subunit of mycobacterium tuberculosis beta- oxidation trifunctional enzyme in complex with oxidized nicotinamide adenine dinucleotide (see paper)
34% identity, 96% coverage: 3:282/291 of query aligns to 316:598/711 of 7o4uA
8oqsB Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-83
34% identity, 96% coverage: 3:282/291 of query aligns to 340:622/735 of 8oqsB
Sites not aligning to the query:
8oqoA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-49
34% identity, 96% coverage: 3:282/291 of query aligns to 333:615/727 of 8oqoA
Sites not aligning to the query:
8oqlA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-1
34% identity, 96% coverage: 3:282/291 of query aligns to 333:615/728 of 8oqlA
Sites not aligning to the query:
4b3iA Crystal structure of mycobacterium tuberculosis fatty acid beta-oxidation complex with coenzymea bound at the hydratase active sites (see paper)
34% identity, 96% coverage: 3:282/291 of query aligns to 336:618/731 of 4b3iA
Sites not aligning to the query:
8oqvA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-109
34% identity, 96% coverage: 3:282/291 of query aligns to 332:614/726 of 8oqvA
Sites not aligning to the query:
8pf8A Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-72
34% identity, 96% coverage: 3:282/291 of query aligns to 334:616/729 of 8pf8A
Sites not aligning to the query:
>3606783 Dshi_0214 3-hydroxybutyryl-CoA dehydrogenase (RefSeq)
MDIKSVGVIGAGQMGNGIAHVFAVAGFDVMMTDISQDALDQAMALIRRNLERQVSREKIS
REDMETAMARITTTLKLPELGQTDLVIEAATERETVKSAIFEDLQPHLKPETILTSNTSS
ISITRLASRTDRPERFMGFHFMNPVPVMQLVELIRGIATDEATYKTLLGVVEKLGKTAAS
AEDFPAFIVNRILMPMINEAVYTLYEGVGSVRSIDESMKLGANHPMGPLELADFIGLDTC
LAIMNVLHDGLADTKYRPCPLLTKYVEAGWLGRKTQRGFYDYRGEVPVPTR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory