Comparing 3606888 FitnessBrowser__Dino:3606888 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 15 hits to proteins with known functional sites (download)
4z9nB Abc transporter / periplasmic binding protein from brucella ovis with glutathione bound
57% identity, 94% coverage: 22:338/338 of query aligns to 5:324/324 of 4z9nB
5t0wA Crystal structure of the ancestral amino acid-binding protein anccdt- 1, a precursor of cyclohexadienyl dehydratase
30% identity, 68% coverage: 24:253/338 of query aligns to 2:218/229 of 5t0wA
1xt8B Crystal structure of cysteine-binding protein from campylobacter jejuni at 2.0 a resolution (see paper)
26% identity, 64% coverage: 23:239/338 of query aligns to 5:213/251 of 1xt8B
6h2tA Glnh bound to glu, mycobacterium tuberculosis (see paper)
28% identity, 62% coverage: 17:225/338 of query aligns to 36:237/288 of 6h2tA
6h20A Glnh bound to asn, mycobacterium tuberculosis (see paper)
28% identity, 62% coverage: 17:225/338 of query aligns to 35:236/287 of 6h20A
6h1uA Glnh bound to asp, mycobacterium tuberculosis (see paper)
28% identity, 62% coverage: 17:225/338 of query aligns to 35:236/287 of 6h1uA
4zv1A An ancestral arginine-binding protein bound to arginine (see paper)
27% identity, 64% coverage: 29:246/338 of query aligns to 1:211/226 of 4zv1A
4zv2A An ancestral arginine-binding protein bound to glutamine (see paper)
27% identity, 64% coverage: 29:246/338 of query aligns to 1:209/225 of 4zv2A
2yjpA Crystal structure of the solute receptors for l-cysteine of neisseria gonorrhoeae (see paper)
26% identity, 67% coverage: 22:249/338 of query aligns to 1:216/247 of 2yjpA
5eyfB Crystal structure of solute-binding protein from enterococcus faecium with bound glutamate
25% identity, 68% coverage: 20:248/338 of query aligns to 1:222/243 of 5eyfB
2v25A Structure of the campylobacter jejuni antigen peb1a, an aspartate and glutamate receptor with bound aspartate (see paper)
22% identity, 64% coverage: 24:239/338 of query aligns to 2:211/231 of 2v25A
2ia4B Crystal structure of novel amino acid binding protein from shigella flexneri
22% identity, 67% coverage: 17:243/338 of query aligns to 1:229/278 of 2ia4B
2vhaA Debp (see paper)
22% identity, 66% coverage: 20:243/338 of query aligns to 3:228/276 of 2vhaA
8ovoA X-ray structure of the sf-iglusnfr-s72a in complex with l-aspartate
21% identity, 66% coverage: 20:243/338 of query aligns to 1:226/503 of 8ovoA
6svfA Crystal structure of the p235gk mutant of argbp from t. Maritima (see paper)
24% identity, 66% coverage: 25:246/338 of query aligns to 3:213/229 of 6svfA
>3606888 FitnessBrowser__Dino:3606888
MKKSVLFGALAAAGLAATGAAADTLEEVQARGAVNCGISTGLVGFASQDANGEWQGFDVA
VCRAVAAAVFGDPTAVNFNPVTNQVRFEVLNSGEIDMLARNTTWTFSRDVDLKLEFTGIN
YYDGQGFMVPKALGVSSATELDGATVCIQKGTTTELNLADFFRANNISFEPVPISTASEA
QQQYLAGACDVYTTDASGLAATRASFESPDEHVVLPEIISKEPLGPLVRHGDNEWGDIVR
WTLNALIAAEELGVTSANVAELAAGTDNPEINRLLGTEGNLGEQLGLSADWAVNVIKAGG
NYGEIFETHIGENTPIGLARGLNAQWTEGGLLYAPPFR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory