Comparing 3606889 Dshi_0319 polar amino acid ABC transporter, inner membrane subunit (RefSeq) to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 2 hits to proteins with known functional sites (download)
4ymtC Crystal structure of an amino acid abc transporter complex with arginines (see paper)
35% identity, 30% coverage: 285:407/411 of query aligns to 94:215/215 of 4ymtC
Sites not aligning to the query:
4ymwC Crystal structure of an amino acid abc transporter with histidines (see paper)
36% identity, 29% coverage: 285:404/411 of query aligns to 94:212/214 of 4ymwC
Sites not aligning to the query:
>3606889 Dshi_0319 polar amino acid ABC transporter, inner membrane subunit (RefSeq)
MTTFSDPPPASGPPNQPFNLGMLINDTRYRGYTFQFIALIALIFFFGWLVSNAIYNLAAL
GQDINFSFLGQPASYEIDQTLIPYTSTDTHMRAAFVGLLNTLLVAFLGCITATIFGVLAG
VLRLSKNWLVAKVMSVYVEIFRNIPVLIWIVIISAVMSQALPQPRAFRGEDATATMVLWD
SVAFTNRGVYIPAPVWNPGSGIVVAVFVLSIIGIFVFRRYAKNLLFNTGKLLPVGRISLA
IFFVPTLLAFFVMGRPIGLDYPELGGFNFRGGINIRGTLIALWFALALYTGAFIAENVRA
GILAVSKGQTEAAAALGMRPNRIMSLIILPQALRVIIPPVISQYLNLTKNSSLAAAIGYM
DLTGTLGGVTLNQTGRSFECVLLLMLFYLLISLSISALMNLYNNAVKLKER
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory