Comparing 3606963 FitnessBrowser__Dino:3606963 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4ry9B Crystal structure of carbohydrate transporter solute binding protein veis_2079 from verminephrobacter eiseniae ef01-2, target efi-511009, a complex with d-talitol
29% identity, 77% coverage: 31:290/337 of query aligns to 10:265/297 of 4ry9B
4ry9A Crystal structure of carbohydrate transporter solute binding protein veis_2079 from verminephrobacter eiseniae ef01-2, target efi-511009, a complex with d-talitol
29% identity, 77% coverage: 31:290/337 of query aligns to 10:265/297 of 4ry9A
2fn8A Thermotoga maritima ribose binding protein ribose bound form (see paper)
28% identity, 81% coverage: 28:301/337 of query aligns to 6:268/292 of 2fn8A
4zjpA Structure of an abc-transporter solute binding protein (sbp_ipr025997) from actinobacillus succinogenes (asuc_0197, target efi-511067) with bound beta-d-ribopyranose
30% identity, 77% coverage: 27:287/337 of query aligns to 6:246/270 of 4zjpA
2ioyA Crystal structure of thermoanaerobacter tengcongensis ribose binding protein (see paper)
28% identity, 80% coverage: 28:298/337 of query aligns to 5:256/274 of 2ioyA
5ibqA Crystal structure of an abc solute binding protein from rhizobium etli cfn 42 (rhe_pf00037,target efi-511357) in complex with alpha-d-apiose
29% identity, 84% coverage: 27:309/337 of query aligns to 6:269/287 of 5ibqA
4ry0A Crystal structure of ribose transporter solute binding protein rhe_pf00037 from rhizobium etli cfn 42, target efi-511357, in complex with d-ribose
29% identity, 84% coverage: 27:309/337 of query aligns to 6:269/287 of 4ry0A
1dbpA Identical mutations at corresponding positions in two homologous proteins with non-identical effects (see paper)
28% identity, 77% coverage: 27:287/337 of query aligns to 5:246/271 of 1dbpA
6hyhA Crystal structure of msmeg_1712 from mycobacterium smegmatis in complex with beta-d-fucofuranose (see paper)
30% identity, 72% coverage: 43:284/337 of query aligns to 21:253/304 of 6hyhA
Sites not aligning to the query:
6hbmA Crystal structure of msmeg_1712 from mycobacterium smegmatis in complex with alpha-l-arabinofuranose (see paper)
30% identity, 72% coverage: 43:284/337 of query aligns to 21:253/304 of 6hbmA
Sites not aligning to the query:
6hbdA Crystal structure of msmeg_1712 from mycobacterium smegmatis in complex with beta-d-galactofuranose (see paper)
30% identity, 72% coverage: 43:284/337 of query aligns to 22:254/305 of 6hbdA
Sites not aligning to the query:
2h3hA Crystal structure of the liganded form of thermotoga maritima glucose binding protein (see paper)
28% identity, 78% coverage: 34:296/337 of query aligns to 11:256/313 of 2h3hA
Sites not aligning to the query:
5dteB Crystal structure of an abc transporter periplasmic solute binding protein (ipr025997) from actinobacillus succinogenes 130z(asuc_0081, target efi-511065) with bound d-allose
26% identity, 79% coverage: 22:287/337 of query aligns to 1:257/287 of 5dteB
3c6qC Apo and ligand-bound form of a thermophilic glucose/xylose binding protein
28% identity, 78% coverage: 34:296/337 of query aligns to 11:256/305 of 3c6qC
Sites not aligning to the query:
8wlbA X-ray structure of enterobacter cloacae allose-binding protein in complex with d-psicose (see paper)
25% identity, 80% coverage: 27:297/337 of query aligns to 5:268/288 of 8wlbA
8wl9A X-ray structure of enterobacter cloacae allose-binding protein in complex with d-ribose (see paper)
25% identity, 80% coverage: 27:297/337 of query aligns to 5:268/288 of 8wl9A
1rpjA Crystal structure of d-allose binding protein from escherichia coli (see paper)
24% identity, 80% coverage: 27:297/337 of query aligns to 5:268/288 of 1rpjA
1gudA Hinge-bending motion of d-allose binding protein from escherichia coli: three open conformations (see paper)
24% identity, 80% coverage: 27:297/337 of query aligns to 5:268/288 of 1gudA
Sites not aligning to the query:
4rxmA Crystal structure of periplasmic abc transporter solute binding protein a7jw62 from mannheimia haemolytica phl213, target efi-511105, in complex with myo-inositol
25% identity, 76% coverage: 34:289/337 of query aligns to 15:256/291 of 4rxmA
Sites not aligning to the query:
2x7xA Fructose binding periplasmic domain of hybrid two component system bt1754 (see paper)
24% identity, 79% coverage: 66:330/337 of query aligns to 42:288/301 of 2x7xA
Sites not aligning to the query:
>3606963 FitnessBrowser__Dino:3606963
MKNLMLGTALACATMSGAALADTTSACLITKTDTNPFFVKMREGAVAKAEELGVELKTFA
GKFDGDHETQVQAIETCILDGAKGILITASDTSSITGAVQQARDAGLVVIALDTPLTPAD
AADATFATDNYVAGLLIGQWARAQMGDAAADAKIAMLNIQVSQPTVGVLRNQGFLEGFGI
DIGDPNRWGDETDPRIVGQDVTQGSEEGGRAAMENILAADPMVNVVYTINEPAAAGAYEA
LKAIGRENDVLIVSVDGGCPGVQNVADGVIGATSQQYPLLMASLGIEAIKTWAETGEKPA
PTPGKDFFDTGVALVTDTPADGVESISVEEGRNLCWG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory