Comparing 3607013 FitnessBrowser__Dino:3607013 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 12 hits to proteins with known functional sites (download)
8crvA Crystal structure of the carbamate kinase from pseudomonas aeruginosa
58% identity, 96% coverage: 1:299/312 of query aligns to 3:302/312 of 8crvA
1e19A Structure of the carbamate kinase-like carbamoyl phosphate synthetase from the hyperthermophilic archaeon pyrococcus furiosus bound to adp (see paper)
45% identity, 96% coverage: 3:301/312 of query aligns to 4:313/313 of 1e19A
4jz8A Carbamate kinase from giardia lamblia bound to citric acid (see paper)
42% identity, 96% coverage: 3:302/312 of query aligns to 7:316/316 of 4jz8A
4jz7C Carbamate kinase from giardia lamblia bound to amp-pnp (see paper)
42% identity, 96% coverage: 3:302/312 of query aligns to 7:316/316 of 4jz7C
4olcA Carbamate kinase from giardia lamblia thiocarbamoylated by disulfiram on cys242 (see paper)
43% identity, 96% coverage: 3:302/312 of query aligns to 6:308/308 of 4olcA
4jz7A Carbamate kinase from giardia lamblia bound to amp-pnp (see paper)
39% identity, 96% coverage: 3:302/312 of query aligns to 7:285/285 of 4jz7A
2we5A Carbamate kinase from enterococcus faecalis bound to mgadp (see paper)
43% identity, 87% coverage: 3:272/312 of query aligns to 4:277/309 of 2we5A
2we4A Carbamate kinase from enterococcus faecalis bound to a sulfate ion and two water molecules, which mimic the substrate carbamyl phosphate (see paper)
43% identity, 87% coverage: 3:272/312 of query aligns to 4:277/309 of 2we4A
Sites not aligning to the query:
P0A2X8 Carbamate kinase 1; EC 2.7.2.2 from Enterococcus faecium (Streptococcus faecium) (see 2 papers)
43% identity, 87% coverage: 3:272/312 of query aligns to 5:278/310 of P0A2X8
Sites not aligning to the query:
4axsA Structure of carbamate kinase from mycoplasma penetrans (see paper)
35% identity, 96% coverage: 3:300/312 of query aligns to 2:290/291 of 4axsA
2btyA Acetylglutamate kinase from thermotoga maritima complexed with its inhibitor arginine (see paper)
35% identity, 37% coverage: 168:281/312 of query aligns to 151:252/282 of 2btyA
Sites not aligning to the query:
Q9X2A4 Acetylglutamate kinase; N-acetyl-L-glutamate 5-phosphotransferase; NAG kinase; NAGK; EC 2.7.2.8 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
35% identity, 37% coverage: 168:281/312 of query aligns to 151:252/282 of Q9X2A4
Sites not aligning to the query:
>3607013 FitnessBrowser__Dino:3607013
MLVVAALGGNALLKRGEPLTAENQRRNVREAAVALARIVRAGHRLVVTHGNGPQVGLLAL
QGAAYKPEEAYPLDVLGAETGGMIGYIIEQELENALDHDRAVATLLTQIVVDPDDLAFRD
PAKFIGPVYSRDEAEARAKAVGWTIAQDGDKWRRVVPSPAPQEIPDMRVIRMLLEQDVIV
ICGGGGGIPVLRRADGSLIGIEAVIDKDAASALLARELEADALLLLTDVDGVYRDFGTDR
QARIDSLTPGEAFKLNLPAGSMGPKMLAAARFAAYGGLAGIGRLDEATDILEGRAGTRVI
PDATDEGGSGRG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory