SitesBLAST
Comparing 3607087 FitnessBrowser__Dino:3607087 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P00046 Cytochrome c from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
37% identity, 24% coverage: 306:403/404 of query aligns to 10:107/109 of P00046
- K77 (≠ D373) modified: N6,N6,N6-trimethyllysine
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
P00049 Cytochrome c from Ustilago sphaerogena (Smut fungus) (see paper)
39% identity, 25% coverage: 306:404/404 of query aligns to 9:107/107 of P00049
- C18 (= C314) binding covalent
- C21 (= C317) binding covalent
P00048 Cytochrome c from Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) (see 5 papers)
37% identity, 24% coverage: 306:403/404 of query aligns to 10:107/108 of P00048
- G11 (= G307) to D: in cyt-12-12/cyc-1-1; characterized by slow growth and a deficiency of spectrophotometrically-detectable cytochromes aa3 and c
- K77 (≠ D373) modified: N6,N6,N6-trimethyllysine
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
P00025 Cytochrome c from Katsuwonus pelamis (Skipjack tuna) (Bonito) (see 2 papers)
38% identity, 24% coverage: 306:403/404 of query aligns to 6:103/104 of P00025
- C15 (= C314) binding covalent
- C18 (= C317) binding covalent
- H19 (= H318) binding axial binding residue
- M81 (= M381) binding axial binding residue
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylglycine
P00012 Cytochrome c from Mirounga leonina (Southern elephant seal) (Phoca leonina) (see paper)
34% identity, 25% coverage: 306:404/404 of query aligns to 6:104/105 of P00012
- C15 (= C314) binding covalent
- C18 (= C317) binding covalent
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylglycine
1cycA The crystal structure of bonito (katsuo) ferrocytochromE C at 2.3 angstroms resolution. Ii. Structure and function (see paper)
38% identity, 24% coverage: 306:403/404 of query aligns to 5:102/103 of 1cycA
- binding heme c: K13 (≠ A313), C14 (= C314), C17 (= C317), H18 (= H318), L32 (= L332), R38 (= R338), Y46 (= Y346), Y48 (= Y348), N52 (≠ L352), T78 (≠ S379), K79 (≠ R380), M80 (= M381), F82 (≠ E383)
P00042 Cytochrome c from Wickerhamomyces anomalus (Yeast) (Hansenula anomala) (see paper)
37% identity, 25% coverage: 303:404/404 of query aligns to 8:109/109 of P00042
- C20 (= C314) binding covalent
- C23 (= C317) binding covalent
- K61 (≠ L355) modified: N6,N6-dimethyllysine; alternate; modified: N6-methyllysine; alternate
- K78 (≠ D373) modified: N6,N6,N6-trimethyllysine
- K79 (≠ A374) modified: N6,N6,N6-trimethyllysine
6suvAaA Cytochrome c
34% identity, 24% coverage: 306:403/404 of query aligns to 5:102/104 of 6suvAaA
- binding heme c: C14 (= C314), C17 (= C317), H18 (= H318), T28 (≠ A328), G29 (= G329), P30 (= P330), L35 (≠ I335), T40 (≠ I340), G41 (≠ A341), Y48 (= Y348), T49 (≠ S349), N52 (≠ L352), W59 (= W359), Y67 (≠ L367), L68 (≠ F368), T78 (≠ S379), K79 (≠ R380), M80 (= M381), F82 (≠ E383)
- binding octa-anionic calixarene: K7 (≠ A308), K8 (≠ E309), V11 (vs. gap), K72 (≠ D373), K73 (≠ A374), P76 (= P377), K86 (≠ P387), K87 (≠ S388), K88 (≠ A389), T89 (≠ A390), E90 (≠ D391)
Sites not aligning to the query:
4rszA The x-ray structure of the primary adduct formed in the reaction between cisplatin and cytochromE C (see paper)
34% identity, 24% coverage: 306:403/404 of query aligns to 5:102/104 of 4rszA
- binding Cisplatin: E61 (≠ A361), M65 (≠ S365), E92 (≠ Q393)
- binding heme c: K13 (≠ A313), C14 (= C314), C17 (= C317), H18 (= H318), G29 (= G329), P30 (= P330), Y48 (= Y348), T49 (≠ S349), N52 (≠ L352), W59 (= W359), Y67 (≠ L367), T78 (≠ S379), K79 (≠ R380), M80 (= M381), I81 (≠ P382)
1wejF Igg1 fab fragment (of e8 antibody) complexed with horse cytochromE C at 1.8 a resolution (see paper)
34% identity, 24% coverage: 306:403/404 of query aligns to 5:102/104 of 1wejF
- binding protoporphyrin ix containing fe: K13 (≠ A313), C14 (= C314), C17 (= C317), H18 (= H318), G29 (= G329), P30 (= P330), G41 (≠ A341), Y48 (= Y348), T49 (≠ S349), N52 (≠ L352), W59 (= W359), Y67 (≠ L367), L68 (≠ F368), T78 (≠ S379), K79 (≠ R380), M80 (= M381), F82 (≠ E383)
1m60A Solution structure of zinc-substituted cytochromE C (see paper)
34% identity, 24% coverage: 306:403/404 of query aligns to 5:102/104 of 1m60A
- binding zinc substituted heme c: K13 (≠ A313), C14 (= C314), C17 (= C317), H18 (= H318), T28 (≠ A328), L32 (= L332), T40 (≠ I340), G41 (≠ A341), Y48 (= Y348), T49 (≠ S349), N52 (≠ L352), W59 (= W359), Y67 (≠ L367), L68 (≠ F368), K79 (≠ R380), M80 (= M381), F82 (≠ E383), L94 (= L395)
1fi7A Solution structure of the imidazole complex of cytochromE C (see paper)
34% identity, 24% coverage: 306:403/404 of query aligns to 5:102/104 of 1fi7A
- binding heme c: C14 (= C314), C17 (= C317), H18 (= H318), T28 (≠ A328), G29 (= G329), P30 (= P330), L32 (= L332), N52 (≠ L352), W59 (= W359), L64 (≠ I364), L68 (≠ F368), K79 (≠ R380)
- binding imidazole: Y67 (≠ L367), K79 (≠ R380)
1akkA Solution structure of oxidized horse heart cytochromE C, nmr, minimized average structure (see paper)
34% identity, 24% coverage: 306:403/404 of query aligns to 5:102/104 of 1akkA
- binding heme c: C14 (= C314), C17 (= C317), H18 (= H318), T28 (≠ A328), T40 (≠ I340), Y48 (= Y348), T49 (≠ S349), N52 (≠ L352), W59 (= W359), Y67 (≠ L367), T78 (≠ S379), K79 (≠ R380), M80 (= M381), F82 (≠ E383), L94 (= L395)
P00004 Cytochrome c from Equus caballus (Horse) (see 2 papers)
34% identity, 24% coverage: 306:403/404 of query aligns to 6:103/105 of P00004
- H19 (= H318) binding axial binding residue
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylglycine
P00017 Cytochrome c from Aptenodytes patagonicus (King penguin)
35% identity, 24% coverage: 306:403/404 of query aligns to 6:103/105 of P00017
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylglycine
6ff5A X-ray structure of bovine heart cytochromE C at high ionic strength (see paper)
34% identity, 24% coverage: 306:403/404 of query aligns to 5:102/104 of 6ff5A
- binding heme c: K13 (≠ A313), C14 (= C314), C17 (= C317), H18 (= H318), G29 (= G329), P30 (= P330), G41 (≠ A341), Y48 (= Y348), T49 (≠ S349), N52 (≠ L352), W59 (= W359), Y67 (≠ L367), T78 (≠ S379), K79 (≠ R380), M80 (= M381), I81 (≠ P382), F82 (≠ E383)
- binding nitrate ion: E69 (= E369), K86 (≠ P387), K87 (≠ S388), E90 (≠ D391)
- binding sulfate ion: K7 (≠ A308), K100 (≠ M401)
Sites not aligning to the query:
P62894 Cytochrome c from Bos taurus (Bovine) (see 3 papers)
34% identity, 24% coverage: 306:403/404 of query aligns to 6:103/105 of P62894
- Y49 (= Y348) modified: Phosphotyrosine
- Y98 (≠ F398) modified: Phosphotyrosine
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylglycine
1lfmA Crystal structure of cobalt(iii)-substituted cytochromE C (tuna) (see paper)
38% identity, 24% coverage: 306:403/404 of query aligns to 5:102/103 of 1lfmA
- binding protoporphyrin ix containing co: C14 (= C314), C17 (= C317), H18 (= H318), V28 (≠ A328), G29 (= G329), P30 (= P330), G41 (≠ A341), Y48 (= Y348), T49 (≠ S349), N52 (≠ L352), W59 (= W359), Y67 (≠ L367), T78 (≠ S379), K79 (≠ R380), M80 (= M381), F82 (≠ E383)
1i54A CytochromE C (tuna) 2fe:1zn mixed-metal porphyrins (see paper)
38% identity, 24% coverage: 306:403/404 of query aligns to 5:102/103 of 1i54A
- binding heme c: C14 (= C314), C17 (= C317), H18 (= H318), V28 (≠ A328), G29 (= G329), P30 (= P330), G41 (≠ A341), Y46 (= Y346), Y48 (= Y348), T49 (≠ S349), N52 (≠ L352), W59 (= W359), Y67 (≠ L367), L68 (≠ F368), T78 (≠ S379), K79 (≠ R380), M80 (= M381), F82 (≠ E383)
- binding protoporphyrin ix containing zn: C14 (= C314), C17 (= C317), H18 (= H318), G29 (= G329), P30 (= P330), G41 (≠ A341), Y46 (= Y346), Y48 (= Y348), T49 (≠ S349), N52 (≠ L352), W59 (= W359), Y67 (≠ L367), L68 (≠ F368), T78 (≠ S379), K79 (≠ R380), M80 (= M381), F82 (≠ E383)
1criA The role of a conserved internal water molecule and its associated hydrogen bond network in cytochromE C (see paper)
36% identity, 24% coverage: 306:403/404 of query aligns to 10:107/108 of 1criA
- binding protoporphyrin ix containing fe: R18 (vs. gap), C19 (= C314), C22 (= C317), H23 (= H318), I40 (= I335), S45 (≠ I340), Y51 (= Y346), Y53 (= Y348), T54 (≠ S349), I57 (≠ L352), W64 (= W359), M69 (≠ I364), T83 (≠ S379), K84 (≠ R380), M85 (= M381), F87 (≠ E383)
Query Sequence
>3607087 FitnessBrowser__Dino:3607087
MRVASTLCAVALASAPVLAQDLRGHGGPVRALATDEAGRIYSGSFDTRAIVWDGFTAMQI
TRHHEGAVTAVVPLEGGRFASGGQDGRVVIWGDSPEPLQSEIWHPLPVGAMVALGDGLAS
AGWDGRIALWSGTGSPSYIEAHEGQITGLIGYRGGLASVGADLRLRLWNPDGTDAGQISL
PAAASALATDGAALFVASPDGILRKVTAITELDEATISSRGLLSVAASEGLVAVGAMTGD
VWLVDPDTLDVQVAIETGQGPIWALAISDGVLLTGGNDGLIRRWSLDGIALGEGSGPPDP
TLTNPRGAEVFRACAVCHTLTPDDGARAGPTLHGIFGRRIATAEGYQYSEALKDLDIVWT
AQTISELFEYGPDAYTPGSRMPEQRVPSAADRQALVEFLEMVTR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory