Comparing 3607097 FitnessBrowser__Dino:3607097 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P04983 Ribose import ATP-binding protein RbsA; EC 7.5.2.7 from Escherichia coli (strain K12) (see paper)
33% identity, 99% coverage: 1:494/498 of query aligns to 7:499/501 of P04983
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
26% identity, 42% coverage: 6:216/498 of query aligns to 12:228/254 of 1g6hA
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
26% identity, 42% coverage: 6:216/498 of query aligns to 12:228/253 of 1g9xB
3c4jA Abc protein artp in complex with atp-gamma-s
29% identity, 45% coverage: 4:227/498 of query aligns to 9:225/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
29% identity, 45% coverage: 4:227/498 of query aligns to 9:225/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
29% identity, 45% coverage: 4:227/498 of query aligns to 9:225/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
29% identity, 45% coverage: 4:227/498 of query aligns to 9:225/242 of 2oljA
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
31% identity, 43% coverage: 1:216/498 of query aligns to 5:214/241 of 4u00A
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
29% identity, 43% coverage: 1:216/498 of query aligns to 4:214/240 of 4ymuJ
6z67B Ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution (see paper)
28% identity, 41% coverage: 14:216/498 of query aligns to 20:217/229 of 6z67B
Sites not aligning to the query:
6z4wA Ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) (see paper)
28% identity, 41% coverage: 14:216/498 of query aligns to 20:217/230 of 6z4wA
Sites not aligning to the query:
7roqA Alternative structure of human abca1
28% identity, 41% coverage: 16:219/498 of query aligns to 789:982/1831 of 7roqA
Sites not aligning to the query:
1ji0A Crystal structure analysis of the abc transporter from thermotoga maritima
29% identity, 47% coverage: 4:236/498 of query aligns to 12:238/240 of 1ji0A
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
30% identity, 43% coverage: 3:217/498 of query aligns to 22:227/378 of P69874
Sites not aligning to the query:
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
29% identity, 44% coverage: 3:219/498 of query aligns to 11:224/375 of 2d62A
3wmgA Crystal structure of an inward-facing eukaryotic abc multidrug transporter g277v/a278v/a279v mutant in complex with an cyclic peptide inhibitor, acap (see paper)
32% identity, 41% coverage: 12:216/498 of query aligns to 358:561/589 of 3wmgA
Sites not aligning to the query:
6a6mA Crystal structure of an outward-open nucleotide-bound state of the eukaryotic abc multidrug transporter cmabcb1 (see paper)
32% identity, 41% coverage: 12:216/498 of query aligns to 359:562/589 of 6a6mA
Sites not aligning to the query:
7fc9A Crystal structure of cmabcb1 in lipidic mesophase revealed by lcp-sfx (see paper)
32% identity, 41% coverage: 12:216/498 of query aligns to 359:562/584 of 7fc9A
Sites not aligning to the query:
7arlD Lolcde in complex with lipoprotein and adp (see paper)
27% identity, 42% coverage: 10:217/498 of query aligns to 18:221/222 of 7arlD
P75957 Lipoprotein-releasing system ATP-binding protein LolD; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
27% identity, 42% coverage: 10:217/498 of query aligns to 21:224/233 of P75957
>3607097 FitnessBrowser__Dino:3607097
MNGLQKSFGKNNVLRGIDLTLDPGSVTVLMGANGAGKSTLVKVICGQHRADGGTMRLATN
AFDPEDAADAIRQGVVTVHQSIDDGVIPDLDVANNLMLDRLAEHSHGLFVRERHLRTEAA
KVAAAMGIEVNLRARVSDLSVADRQMIAIARAMARAPKVLILDEPTSSLSATEADRLFEL
IDRLRAQGVAILYISHRMSDIRRIADRIVVMRDGMISGVFETEPLDLEAAVTAMLGHRMT
EVDAEVRQGTHPVLEIKNLQLFEGASPITLTAHDGEVVALVGLLGSGKSRLAEILFGIAR
PIRGSIRIKGKDYSPRSVKDAIAQGVFMSPKDRGTNAVIPAFDIADNMTLPFLQGMSVGS
FLKSRQQRGTAQGMVDRLGIVCQSVRDGIGTLSGGNQQKVMIARWLLEPAQVLLLDEPFQ
GVDIGARRDIGHHIRATTQGRATLVFLAEIDEALEIADRIVVMSEGAIVGEHTNRNIDLA
ALVADISGATSTVTGTSP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory