SitesBLAST
Comparing 3607104 FitnessBrowser__Dino:3607104 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 5 hits to proteins with known functional sites (download)
P76014 PEP-dependent dihydroxyacetone kinase, ADP-binding subunit DhaL; EC 2.7.1.121 from Escherichia coli (strain K12) (see 3 papers)
27% identity, 98% coverage: 1:196/199 of query aligns to 1:208/210 of P76014
4lrzA Crystal structure of the e.Coli dhar(n)-dhal complex (see paper)
27% identity, 98% coverage: 2:196/199 of query aligns to 3:209/211 of 4lrzA
- binding adenosine-5'-diphosphate: D31 (= D30), D36 (= D35), D38 (= D37), H39 (≠ L38), G79 (≠ S77), A80 (≠ S78), S81 (≠ Y79), L84 (= L82), G122 (= G120), T130 (= T128), M131 (≠ V129), G178 (= G169), D192 (= D183), P193 (= P184), G194 (= G185)
- binding magnesium ion: D31 (= D30), D36 (= D35), D36 (= D35), D38 (= D37), D38 (= D37)
3cr3A Structure of a transient complex between dha-kinase subunits dham and dhal from lactococcus lactis (see paper)
28% identity, 92% coverage: 3:185/199 of query aligns to 2:176/192 of 3cr3A
- binding adenosine-5'-diphosphate: D29 (= D30), D34 (= D35), D36 (= D37), H37 (≠ L38), N40 (≠ T41), G77 (≠ S77), A78 (≠ S78), S79 (≠ Y79), L82 (= L82), G115 (= G120), A117 (= A122), T123 (= T128), D174 (= D183), P175 (= P184), G176 (= G185)
- binding magnesium ion: D29 (= D30), D34 (= D35), D34 (= D35), D36 (= D37), D36 (= D37)
Q9CIV7 PTS-dependent dihydroxyacetone kinase, ADP-binding subunit DhaL; EC 2.7.1.121 from Lactococcus lactis subsp. lactis (strain IL1403) (Streptococcus lactis) (see paper)
28% identity, 92% coverage: 3:185/199 of query aligns to 2:176/192 of Q9CIV7
- D29 (= D30) binding
- D34 (= D35) binding
- D36 (= D37) binding
- HGAN 37:40 (≠ LGVT 38:41) binding
- AS 78:79 (≠ SY 78:79) binding
- R114 (= R119) mutation to A: Reduces activity 3-fold.; mutation to E: Reduces activity 100-fold.
- G115 (= G120) binding
- M124 (≠ V129) binding
- R161 (= R170) mutation to A: Loss of activity.
- Y164 (≠ I173) mutation to A: Reduces activity about 20-fold.
- DPG 174:176 (= DPG 183:185) binding
Q3LXA3 Triokinase/FMN cyclase; Bifunctional ATP-dependent dihydroxyacetone kinase/FAD-AMP lyase (cyclizing); EC 2.7.1.28; EC 2.7.1.29; EC 4.6.1.15 from Homo sapiens (Human) (see 4 papers)
30% identity, 87% coverage: 12:185/199 of query aligns to 378:558/575 of Q3LXA3
- D401 (= D35) mutation to A: Abolishes both kinase and FMN cyclase activities.
- D403 (= D37) mutation to A: Abolishes both kinase and FMN cyclase activities.
- C404 (≠ L38) mutation to A: Decreases both kinase and FMN cyclase activities.
- G445 (≠ S77) to S: in TKFCD; very severe decrease of triokinase and glycerone kinase activities; dbSNP:rs1590578831
- S446 (= S78) mutation to A: Decreases both kinase and FMN cyclase activities.
- R543 (= R170) to I: in TKFCD; reduced protein levels in patient cells; very severe decrease of triokinase and glycerone kinase activities; dbSNP:rs547013163
- D556 (= D183) mutation to A: Abolishes both kinase and FMN cyclase activities.
Sites not aligning to the query:
- 112 T→A: Highly decreases kinase activity. No effect on FMN cyclase activity.
- 185 A → T: in dbSNP:rs2260655
- 204 K→A: Slightly decreases kinase activity. No effect on FMN cyclase activity.
- 221 H→A: Abolishes kinase activity but not FMN cyclase activity.
Query Sequence
>3607104 FitnessBrowser__Dino:3607104
MTITRDTLLGAIDRIAAAMERDFDLLNSADAALGDGDLGVTMTRGMRAIVAMKDDLPEDI
GMALLGCAQAFTKSSGSSYGTLMATGLMSAAKELRGQQEIESESIPGLIAGARDKMQERG
KAELGGKTVLDSLDYVARTTDKADDKASAAAEAVDRALEDFRDKPATVGRARIFGEKSIG
LDDPGMLAMQSVVRAAVDK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory