SitesBLAST
Comparing 3607108 FitnessBrowser__Dino:3607108 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P04983 Ribose import ATP-binding protein RbsA; EC 7.5.2.7 from Escherichia coli (strain K12) (see paper)
36% identity, 95% coverage: 8:478/498 of query aligns to 3:473/501 of P04983
- K43 (= K48) mutation to R: Loss of transport.
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
32% identity, 44% coverage: 15:232/498 of query aligns to 7:222/240 of 4ymuJ
- binding adenosine-5'-triphosphate: F11 (≠ Y19), V16 (≠ A24), S36 (≠ N44), G37 (= G45), S38 (= S46), G39 (= G47), K40 (= K48), S41 (= S49), T42 (= T50), E162 (= E172), H194 (= H204)
- binding magnesium ion: S41 (= S49), E162 (= E172)
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
29% identity, 45% coverage: 7:232/498 of query aligns to 15:234/378 of P69874
- C26 (≠ R18) mutation to A: Lower ATPase activity and transport efficiency.
- F27 (≠ Y19) mutation to L: Lower ATPase activity and transport efficiency.
- F45 (≠ A37) mutation to L: Lower ATPase activity and transport efficiency.
- C54 (≠ S46) mutation to T: Loss of ATPase activity and transport.
- L60 (≠ I52) mutation to F: Lower ATPase activity and transport efficiency.
- L76 (≠ I68) mutation to P: Lower ATPase activity and transport efficiency.
- V135 (≠ I134) mutation to M: Loss of ATPase activity and transport.
- D172 (= D171) mutation to N: Loss of ATPase activity and transport.
Sites not aligning to the query:
- 276 C→A: Lower ATPase activity and transport efficiency.
- 297 mutation E->K,D: Lower ATPase activity and transport efficiency.; E→Q: Loss of ATPase activity and transport.
P75831 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
33% identity, 45% coverage: 7:232/498 of query aligns to 2:229/648 of P75831
- K47 (= K48) mutation to L: Lack of activity.
- D169 (= D171) mutation to N: Lack of activity.
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
31% identity, 46% coverage: 10:236/498 of query aligns to 3:226/241 of 4u00A
3c4jA Abc protein artp in complex with atp-gamma-s
30% identity, 45% coverage: 10:234/498 of query aligns to 4:227/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
30% identity, 45% coverage: 10:234/498 of query aligns to 4:227/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
30% identity, 45% coverage: 10:234/498 of query aligns to 4:227/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
30% identity, 45% coverage: 10:234/498 of query aligns to 4:227/242 of 2oljA
2awnB Crystal structure of the adp-mg-bound e. Coli malk (crystallized with atp-mg) (see paper)
31% identity, 43% coverage: 8:223/498 of query aligns to 1:210/374 of 2awnB
P19566 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
31% identity, 43% coverage: 8:223/498 of query aligns to 2:211/369 of P19566
- L86 (= L95) mutation to F: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
- P160 (= P173) mutation to L: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
- D165 (≠ T178) mutation to N: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
Sites not aligning to the query:
- 306 E→K: Loss of transport. No effect on ATP-binding and ATP hydrolysis. Retains repressor activity.
3puyA Crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state (see paper)
31% identity, 43% coverage: 8:223/498 of query aligns to 1:210/371 of 3puyA
- binding phosphoaminophosphonic acid-adenylate ester: W12 (≠ Y19), S37 (≠ N44), G38 (= G45), C39 (≠ S46), G40 (= G47), K41 (= K48), S42 (= S49), T43 (= T50), Q81 (= Q91), R128 (≠ A142), A132 (≠ T146), S134 (≠ P148), G136 (≠ A150), Q137 (= Q151), E158 (= E172), H191 (= H204)
- binding magnesium ion: S42 (= S49), Q81 (= Q91)
3puxA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-bef3 (see paper)
31% identity, 43% coverage: 8:223/498 of query aligns to 1:210/371 of 3puxA
- binding adenosine-5'-diphosphate: W12 (≠ Y19), G38 (= G45), C39 (≠ S46), G40 (= G47), K41 (= K48), S42 (= S49), T43 (= T50), R128 (≠ A142), S134 (≠ P148), Q137 (= Q151)
- binding beryllium trifluoride ion: S37 (≠ N44), G38 (= G45), K41 (= K48), Q81 (= Q91), S134 (≠ P148), G136 (≠ A150), H191 (= H204)
- binding magnesium ion: S42 (= S49), Q81 (= Q91)
3puwA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-alf4 (see paper)
31% identity, 43% coverage: 8:223/498 of query aligns to 1:210/371 of 3puwA
- binding adenosine-5'-diphosphate: W12 (≠ Y19), V17 (≠ A24), G38 (= G45), C39 (≠ S46), G40 (= G47), K41 (= K48), S42 (= S49), T43 (= T50), R128 (≠ A142), A132 (≠ T146), S134 (≠ P148), Q137 (= Q151)
- binding tetrafluoroaluminate ion: S37 (≠ N44), G38 (= G45), K41 (= K48), Q81 (= Q91), S134 (≠ P148), G135 (≠ V149), G136 (≠ A150), E158 (= E172), H191 (= H204)
- binding magnesium ion: S42 (= S49), Q81 (= Q91)
3puvA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-vo4 (see paper)
31% identity, 43% coverage: 8:223/498 of query aligns to 1:210/371 of 3puvA
- binding adenosine-5'-diphosphate: W12 (≠ Y19), V17 (≠ A24), G38 (= G45), C39 (≠ S46), G40 (= G47), K41 (= K48), S42 (= S49), T43 (= T50), R128 (≠ A142), A132 (≠ T146), S134 (≠ P148), Q137 (= Q151)
- binding magnesium ion: S42 (= S49), Q81 (= Q91)
P68187 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Escherichia coli (strain K12) (see 5 papers)
31% identity, 43% coverage: 8:223/498 of query aligns to 2:211/371 of P68187
- A85 (≠ S94) mutation to M: Suppressor of EAA loop mutations in MalFG.
- K106 (≠ Q115) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V114 (= V123) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V117 (≠ I126) mutation to M: Suppressor of EAA loop mutations in MalFG.
- E119 (≠ R128) mutation to K: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- A124 (≠ Q137) mutation to T: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- G137 (≠ A150) mutation to A: Loss of maltose transport. Has greater ability to decrease mal gene expression than wild-type MalK.
- D158 (= D171) mutation to N: Loss of maltose transport but retains ability to repress mal genes.
Sites not aligning to the query:
- 228 R→C: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 241 F→I: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 267 W→G: Normal maltose transport but constitutive mal gene expression.
- 278 G→P: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 282 S→L: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 284 G→S: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 302 G→D: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 308 E→Q: Maltose transport is affected but retains ability to interact with MalT.
- 322 S→F: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 340 G→A: Maltose transport is affected but retains ability to interact with MalT.
- 346 G→S: Normal maltose transport but constitutive mal gene expression.
- 355 F→Y: Maltose transport is affected but retains ability to interact with MalT.
1q12A Crystal structure of the atp-bound e. Coli malk (see paper)
31% identity, 43% coverage: 10:223/498 of query aligns to 1:208/367 of 1q12A
- binding adenosine-5'-triphosphate: W10 (≠ Y19), S35 (≠ N44), G36 (= G45), C37 (≠ S46), G38 (= G47), K39 (= K48), S40 (= S49), T41 (= T50), R126 (≠ A142), A130 (≠ T146), S132 (≠ P148), G134 (≠ A150), Q135 (= Q151)
6z4wA Ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) (see paper)
27% identity, 45% coverage: 8:233/498 of query aligns to 2:226/230 of 6z4wA
6z67B Ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution (see paper)
27% identity, 45% coverage: 8:233/498 of query aligns to 2:226/229 of 6z67B
P9WQI3 Trehalose import ATP-binding protein SugC; MtbSugC; Nucleotide-binding domain of SugABC transporter; NBD of SugABC transporter; SugABC transporter ATPase SugC; EC 7.5.2.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
29% identity, 45% coverage: 8:233/498 of query aligns to 2:230/393 of P9WQI3
- H193 (= H204) mutation to A: Decreased hydrolysis of ATP. No change in KM, but 2-fold reduction in Vmax compared to wild-type.
Query Sequence
>3607108 FitnessBrowser__Dino:3607108
MSSDHDTAFIDLRAITKRYAGVTALDSVDFTVQPGEAVCLAGENGSGKSTLIKIISGVEP
ATAGTVQIAGQEHVTLNPRISAAAGVMVIFQDFSLFPNLSVAENIAFTTQLSTRQRLFKF
RAVRDIARAALDRIGVQIDLDARVETLPVAQKQLVAICRALASKAQLIIMDEPTTALTEK
EVRRLQGIIRMLKEEGVAVIFVSHKLAEVLEVSEKVVVLRNGKKVAEGPASEFDTQSLTY
HMTGRDVPEVPPSDVAAGAQTLMQVQGLGKAGSFSDISFDLRTGEVLGITGLLGCGRTSV
AKALFGLVTPDAGSILVDGSPVPLGDPQAASLARIGYVPEDRLTEGLFLSQSILRNVAVG
RLDAHTSGGFLDMTGLAKEASDWLRRLKVKAPDVEAPVQSLSGGNQQRVALARWLSRAPR
VLILNGPSVGVDVGSKADIHDIIRELAREGIGVIVISDDLPELLATCHRVLVMREGRIID
ALEGTALTEDDLAHRLAS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory