Comparing 3607109 FitnessBrowser__Dino:3607109 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4wzzA Crystal structure of an abc transporter solute binding protein (ipr025997) from clostridium phytofermentas (cphy_0583, target efi- 511148) with bound l-rhamnose
27% identity, 78% coverage: 33:287/329 of query aligns to 8:266/321 of 4wzzA
4pz0A The crystal structure of a solute binding protein from bacillus anthracis str. Ames in complex with quorum-sensing signal autoinducer-2 (ai-2)
26% identity, 86% coverage: 32:313/329 of query aligns to 10:292/321 of 4pz0A
5hqjA Crystal structure of abc transporter solute binding protein b1g1h7 from burkholderia graminis c4d1m, target efi-511179, in complex with d-arabinose
27% identity, 83% coverage: 26:298/329 of query aligns to 3:276/289 of 5hqjA
1tjyA Crystal structure of salmonella typhimurium ai-2 receptor lsrb in complex with r-thmf (see paper)
24% identity, 85% coverage: 27:306/329 of query aligns to 1:280/316 of 1tjyA
3ejwA Crystal structure of the sinorhizobium meliloti ai-2 receptor, smlsrb (see paper)
25% identity, 86% coverage: 32:313/329 of query aligns to 4:286/315 of 3ejwA
3t95A Crystal structure of lsrb from yersinia pestis complexed with autoinducer-2 (see paper)
23% identity, 91% coverage: 32:329/329 of query aligns to 4:314/314 of 3t95A
5dteB Crystal structure of an abc transporter periplasmic solute binding protein (ipr025997) from actinobacillus succinogenes 130z(asuc_0081, target efi-511065) with bound d-allose
27% identity, 70% coverage: 32:260/329 of query aligns to 5:238/287 of 5dteB
Sites not aligning to the query:
3c6qC Apo and ligand-bound form of a thermophilic glucose/xylose binding protein
24% identity, 87% coverage: 43:327/329 of query aligns to 14:292/305 of 3c6qC
Sites not aligning to the query:
2h3hA Crystal structure of the liganded form of thermotoga maritima glucose binding protein (see paper)
24% identity, 87% coverage: 43:327/329 of query aligns to 14:292/313 of 2h3hA
Sites not aligning to the query:
6dspA Lsrb from clostridium saccharobutylicum in complex with ai-2 (see paper)
23% identity, 81% coverage: 32:299/329 of query aligns to 3:281/326 of 6dspA
6gt9A Crystal structure of ganp, a glucose-galactose binding protein from geobacillus stearothermophilus, in complex with galactose
24% identity, 75% coverage: 43:290/329 of query aligns to 20:265/283 of 6gt9A
Sites not aligning to the query:
6guqA Crystal structure of ganp, a glucose-galactose binding protein from geobacillus stearothermophilus, in complex with glucose
24% identity, 75% coverage: 43:290/329 of query aligns to 15:260/278 of 6guqA
Sites not aligning to the query:
4rsmA Crystal structure of carbohydrate transporter msmeg_3599 from mycobacterium smegmatis str. Mc2 155, target efi-510970, in complex with d-threitol (see paper)
26% identity, 72% coverage: 48:285/329 of query aligns to 20:267/315 of 4rsmA
Sites not aligning to the query:
4wutA Crystal structure of an abc transporter solute binding protein (ipr025997) from agrobacterium vitis (avi_5133, target efi-511220) with bound d-fucose
26% identity, 63% coverage: 31:237/329 of query aligns to 2:211/290 of 4wutA
Sites not aligning to the query:
4pe6B Crystal structure of abc transporter solute binding protein from thermobispora bispora dsm 43833
27% identity, 52% coverage: 46:215/329 of query aligns to 22:187/324 of 4pe6B
Sites not aligning to the query:
A0QYB5 D-threitol-binding protein from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
26% identity, 72% coverage: 48:285/329 of query aligns to 52:299/349 of A0QYB5
Sites not aligning to the query:
4yo7A Crystal structure of an abc transporter solute binding protein (ipr025997) from bacillus halodurans c-125 (bh2323, target efi- 511484) with bound myo-inositol
26% identity, 80% coverage: 42:305/329 of query aligns to 18:276/287 of 4yo7A
Sites not aligning to the query:
5hkoA Crystal structure of abc transporter solute binding protein msmeg_3598 from mycobacterium smegmatis str. Mc2 155, target efi-510969, in complex with l-sorbitol
27% identity, 66% coverage: 68:285/329 of query aligns to 38:266/314 of 5hkoA
Sites not aligning to the query:
4rs3A Crystal structure of carbohydrate transporter a0qyb3 from mycobacterium smegmatis str. Mc2 155, target efi-510969, in complex with xylitol (see paper)
27% identity, 66% coverage: 68:285/329 of query aligns to 38:266/315 of 4rs3A
Sites not aligning to the query:
A0QYB3 Xylitol-binding protein from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
27% identity, 66% coverage: 68:285/329 of query aligns to 71:299/349 of A0QYB3
Sites not aligning to the query:
>3607109 FitnessBrowser__Dino:3607109
MKTKFTLLASVAMASSALFATQAVADGHSKDIATVVKIAGIQWFNRMEEGVKKFAEETGM
NAFQVGPAQADPQQQVALIEDMIAQGVDALAVVPMSPEALEPVLGRAMEAGITVITHEAA
AQQNTTYDLEAFVNEDFGANLMEQLATCMGGEGEYAVFVGSLTSQTHNQWVDGAIAYQEA
NYPNMTLVGDKNETFDDAEQAYTKTQEVLRAFPNIKGMQGSASTDVAGIGRAIEERGMED
ATCVFGTSLPSIAGQYLETGAVDGIGFWDPAVAGEAMNKLAVMVMNGEEVTDGMDLGLPG
YESVSLDGKVIYGQAWVNVDAENMSEYPF
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory