Comparing 3607115 FitnessBrowser__Dino:3607115 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3l0qA The crystal structure of xlylulose kinase from yersinia pseudotuberculosis
29% identity, 98% coverage: 2:488/497 of query aligns to 2:530/541 of 3l0qA
3qdkA Structural insight on mechanism and diverse substrate selection strategy of ribulokinase (see paper)
30% identity, 98% coverage: 3:488/497 of query aligns to 2:528/546 of 3qdkA
5ya2A Crystal structure of lsrk-hpr complex with adp (see paper)
28% identity, 96% coverage: 3:479/497 of query aligns to 4:474/478 of 5ya2A
5ya1A Crystal structure of lsrk-hpr complex with atp (see paper)
28% identity, 96% coverage: 3:479/497 of query aligns to 4:474/478 of 5ya1A
3ll3A The crystal structure of ligand bound xylulose kinase from lactobacillus acidophilus
24% identity, 100% coverage: 1:497/497 of query aligns to 2:490/492 of 3ll3A
3ll3B The crystal structure of ligand bound xylulose kinase from lactobacillus acidophilus
23% identity, 100% coverage: 1:497/497 of query aligns to 1:488/490 of 3ll3B
P09099 Xylulose kinase; XK; Xylulokinase; 1-deoxy-D-xylulokinase; EC 2.7.1.17; EC 2.7.1.- from Escherichia coli (strain K12) (see paper)
27% identity, 89% coverage: 4:443/497 of query aligns to 2:432/484 of P09099
2itmA Crystal structure of the e. Coli xylulose kinase complexed with xylulose (see paper)
26% identity, 89% coverage: 4:443/497 of query aligns to 2:424/476 of 2itmA
6k76A Glycerol kinase form thermococcus kodakarensis, complex structure with substrate.
26% identity, 94% coverage: 5:470/497 of query aligns to 2:457/485 of 6k76A
5gn6A Crystal structure of glycerol kinase from trypanosoma brucei gambiense complexed with cumarin derivative-17b (see paper)
26% identity, 87% coverage: 1:430/497 of query aligns to 3:447/513 of 5gn6A
5gn5A Crystal structure of glycerol kinase from trypanosoma brucei gambiense complexed with cumarin derivative-17 (see paper)
26% identity, 87% coverage: 1:430/497 of query aligns to 3:447/513 of 5gn5A
6jafA Crystal structure of trypanosoma brucei gambiense glycerol kinase complex with ppi (pyrophosphatase reaction)
26% identity, 87% coverage: 1:430/497 of query aligns to 3:447/513 of 6jafA
6j9qA Crystal structure of trypanosoma brucei gambiense glycerol kinase complex with amp-pnp.
26% identity, 87% coverage: 1:430/497 of query aligns to 3:447/513 of 6j9qA
5aziA Crystal structure of glycerol kinase from trypanosoma brucei gambiense complexed with 4np (see paper)
26% identity, 87% coverage: 1:430/497 of query aligns to 3:447/513 of 5aziA
3wxlA Crystal structure of trypanosoma brucei gambiense glycerol kinase complex with adp, mg2+, and glycerol (see paper)
26% identity, 87% coverage: 1:430/497 of query aligns to 3:447/513 of 3wxlA
3wxjB Crystal structure of trypanosoma brucei gambiense glycerol kinase in complex with glycerol 3-phosphate (see paper)
26% identity, 87% coverage: 1:430/497 of query aligns to 3:447/513 of 3wxjB
Q9NJP9 Glycerol kinase, glycosomal; GK; Glycerokinase; ATP:glycerol 3-phosphotransferase; EC 2.7.1.30 from Trypanosoma brucei brucei (see 2 papers)
26% identity, 87% coverage: 1:430/497 of query aligns to 1:445/512 of Q9NJP9
6udeB Crystal structure of glycerol kinase from elizabethkingia anophelis nuhp1 in complex with adp and glycerol
23% identity, 91% coverage: 4:455/497 of query aligns to 5:455/495 of 6udeB
O34154 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Enterococcus faecalis (strain ATCC 700802 / V583) (see 2 papers)
24% identity, 94% coverage: 3:469/497 of query aligns to 6:472/501 of O34154
Sites not aligning to the query:
O34153 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Enterococcus casseliflavus (Enterococcus flavescens) (see 3 papers)
23% identity, 94% coverage: 3:469/497 of query aligns to 6:473/506 of O34153
>3607115 FitnessBrowser__Dino:3607115
MAYFLAADGGTESLRVRIYDINGVCVASHAEPYETTFSPGARAEQNPEDWWICLCKASRA
SLAEAGLAGEQIDAMAYATTSCTVVALDKAGKPLRPALLWMDVRADQEAEAVLATGDARL
RLNSDGAGPVSAEWMIPKALWIKRNEPDVYDAAATICEYQDYLTLRLTGERCASLNNVGL
RWHYANRDGGWAESLVTALGMPDLVEKWPARVAAPGEVVGSLTPDAAEALGLTPKTKLVQ
GGADALIGMIGLGVSQPGQLCLITGSSHLQFGVTEKPFHAPGMWGAYADIVYPGRHIVEG
GQTSTGSIINWLRRFVGGEFDIDEMNRKAAALPPGSEGLVVQDHFQGNRTPYTDARSRGA
ITGLTLAHEPHHVFRAIMEGISMGTRAILDSFAKGGYEGSEMVAGGGATNSDLFMQIHAD
TAGIPVRIPASTDGPTLGSAILAAHGAGYFATIDEGIAAMVKPGRVIEPNPKAVQAYEEI
YARYLALYPALSGALAR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory