SitesBLAST
Comparing 3607123 FitnessBrowser__Dino:3607123 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2fdrA Crystal structure of conserved haloacid dehalogenase-like protein of unknown function atu0790 from agrobacterium tumefaciens str. C58
33% identity, 89% coverage: 21:239/246 of query aligns to 3:218/222 of 2fdrA
3s6jE The crystal structure of a hydrolase from pseudomonas syringae
31% identity, 78% coverage: 24:216/246 of query aligns to 6:200/220 of 3s6jE
- active site: D8 (= D26), D10 (= D28), S16 (= S34), I44 (≠ F62), T110 (≠ S126), S111 (= S127), K143 (= K159), G167 (≠ E183), D168 (= D184)
- binding calcium ion: D8 (= D26), D10 (= D28), D168 (= D184)
4eenA Crystal structure of had family hydrolase dr_1622 from deinococcus radiodurans r1 (target efi-501256) with bound magnesium
32% identity, 67% coverage: 21:186/246 of query aligns to 5:171/229 of 4eenA
- active site: D10 (= D26), D12 (= D28), V16 (≠ A32), S18 (= S34), M44 (≠ Q60), Y45 (≠ K61), T47 (≠ L63), S109 (= S126), N110 (≠ S127), K144 (= K159), E168 (= E183), D169 (= D184)
- binding magnesium ion: D10 (= D26), D12 (= D28), D169 (= D184)
Q8VZ10 Protein SUPPRESSOR OF QUENCHING 1, chloroplastic; EC 3.1.3.- from Arabidopsis thaliana (Mouse-ear cress) (see paper)
29% identity, 75% coverage: 14:198/246 of query aligns to 68:256/1055 of Q8VZ10
- D80 (= D26) mutation to N: Complete rescue in complementation test of the nonphotochemical quenching (NPQ) phenotype observed in disrupted plants.
Sites not aligning to the query:
- 431:434 CINC→SINS: No rescue in complementation test of the nonphotochemical quenching (NPQ) phenotype observed in disrupted plants.
- 859 E→K: In soq1-2; high light intensity-dependent and irreversible nonphotochemical quenching (NPQ) due to a decrease in chlorophyll excited-state lifetime.
4uasA Crystal structure of cbby from rhodobacter sphaeroides in complex with phosphate (see paper)
27% identity, 74% coverage: 20:200/246 of query aligns to 2:192/225 of 4uasA
- active site: D8 (= D26), V9 (≠ F27), D10 (= D28), T16 (≠ S34), T47 (≠ L63), T115 (≠ S126), T116 (≠ S127), K151 (= K159), E175 (= E183), D176 (= D184)
- binding magnesium ion: D8 (= D26), D10 (= D28), D176 (= D184)
- binding phosphate ion: D8 (= D26), V9 (≠ F27), D10 (= D28), T115 (≠ S126), T116 (≠ S127), K151 (= K159)
P95649 Protein CbbY; RuCbby; EC 3.1.3.- from Cereibacter sphaeroides (Rhodobacter sphaeroides) (see paper)
27% identity, 74% coverage: 20:200/246 of query aligns to 2:192/230 of P95649
- D10 (= D28) mutation to N: Loss of catalytic activity.
- E17 (= E35) mutation to A: 40% to 80% decreased catalytic activity with xylulose-1,5-bisphosphate, but no effect on activity with ribulose-1,5-bisphosphate.
- H20 (≠ S38) mutation to A: 40% to 80% decreased catalytic activity with xylulose-1,5-bisphosphate, but no effect on activity with ribulose-1,5-bisphosphate.
- Y42 (≠ I58) mutation to A: 40% to 80% decreased catalytic activity with xylulose-1,5-bisphosphate, but no effect on activity with ribulose-1,5-bisphosphate.
- R54 (vs. gap) mutation to A: 97% decreased catalytic activity with xylulose-1,5-bisphosphate, but no effect on activity with ribulose-1,5-bisphosphate.
- K78 (≠ E93) mutation to A: 40% to 80% decreased catalytic activity with xylulose-1,5-bisphosphate, but no effect on activity with ribulose-1,5-bisphosphate.
4uauA Crystal structure of cbby (mutant d10n) from rhodobacter sphaeroides in complex with xylulose-(1,5)bisphosphate, crystal form ii (see paper)
26% identity, 74% coverage: 20:200/246 of query aligns to 2:192/226 of 4uauA
- active site: D8 (= D26), V9 (≠ F27), N10 (≠ D28), T16 (≠ S34), T47 (≠ L63), T115 (≠ S126), T116 (≠ S127), K151 (= K159), E175 (= E183), D176 (= D184)
- binding magnesium ion: D8 (= D26), N10 (≠ D28), D176 (= D184)
- binding xylulose-1,5-bisphosphate: D8 (= D26), V9 (≠ F27), N10 (≠ D28), E17 (= E35), H20 (≠ S38), T49 (≠ K65), G50 (≠ S66), G51 (≠ L67), R54 (vs. gap), H75 (≠ W90), K78 (≠ E93), T115 (≠ S126), T116 (≠ S127), T117 (≠ G128), S118 (≠ T129)
P71447 Beta-phosphoglucomutase; Beta-PGM; EC 5.4.2.6 from Lactococcus lactis subsp. lactis (strain IL1403) (Streptococcus lactis) (see 3 papers)
28% identity, 73% coverage: 23:201/246 of query aligns to 5:187/221 of P71447
- D8 (= D26) modified: 4-aspartylphosphate; mutation to A: Inactive.; mutation to E: Inactive.
- D10 (= D28) mutation to A: Inactive.; mutation to E: Inactive.; mutation to N: Inactive.; mutation to S: Inactive.
- T16 (≠ S34) mutation to P: 500-fold reduction in the rate constant for Asp-8 phosphorylation by beta-G1,6bisP. 6,700-fold reduction in the apparent rate constant for cycling of the phosphorylated enzyme to convert beta-G1P to G6P. 13-fold increase in the estimated rate constant for phosphoryl transfer from the phospho-Asp8 to water.
- H20 (≠ S38) mutation to A: Impairs Asp-8 phosphorylation by beta-G1,6bisP and phosphoryl transfer from the phospho-Asp8 to the substrate beta-G1P.; mutation to N: 300-fold reduction in the conversion of beta-G1P to G6P in the presence of beta-G1,6bisP.; mutation to Q: 8-fold reduction in the conversion of beta-G1P to G6P in the presence of beta-G1,6bisP.
- K45 (≠ L63) mutation to A: 20'000-fold decrease in kcat/KM.
- G46 (= G64) mutation to A: 1'000'000-fold decrease in kcat/KM.; mutation to P: 100'000-fold decrease in kcat/KM.; mutation to V: 10'000-fold decrease in kcat/KM.
- R49 (vs. gap) mutation to K: 1'000'000-fold decrease in kcat/KM.
- S52 (= S66) mutation to A: Wild-type activity.
- K76 (≠ Q91) mutation to A: 100-fold reduction in the conversion of beta-G1P to G6P in the presence of beta-G1,6bisP.
- D170 (= D184) mutation to A: Impaired, but active with an increase in the affinity for G1P.
5olwA 5-fluorotryptophan labeled beta-phosphoglucomutase in an open conformation (see paper)
28% identity, 73% coverage: 23:201/246 of query aligns to 5:187/224 of 5olwA
- active site: D8 (= D26), L9 (≠ F27), D10 (= D28), T16 (≠ S34), K45 (≠ L63), S114 (= S126), A115 (vs. gap), K145 (= K159), E169 (= E183), D170 (= D184)
- binding calcium ion: D8 (= D26), D10 (= D28), P89 (= P104), V92 (vs. gap), E124 (≠ S138), N127 (≠ S141), E169 (= E183), D170 (= D184), S171 (= S185)
6qzgA Beta-glucose 1,6-bisphosphonate bound to wild type beta- phosphoglucomutse in an open conformation.
28% identity, 73% coverage: 23:201/246 of query aligns to 5:187/219 of 6qzgA
- binding 3,7-anhydro-1,2,8-trideoxy-1,8-diphosphono-D-glycero-D-gulo-octitol: D8 (= D26), L9 (≠ F27), D10 (= D28), H20 (≠ S38), G46 (= G64), S114 (= S126), A115 (vs. gap), S116 (vs. gap), K117 (vs. gap), K145 (= K159)
- binding magnesium ion: D8 (= D26), D10 (= D28), D170 (= D184)
1z4nA Structure of beta-phosphoglucomutase with inhibitor bound alpha- galactose 1-phosphate cocrystallized with fluoride (see paper)
28% identity, 73% coverage: 23:201/246 of query aligns to 5:187/219 of 1z4nA
- active site: D8 (= D26), L9 (≠ F27), D10 (= D28), T16 (≠ S34), K45 (≠ L63), S114 (= S126), A115 (vs. gap), K145 (= K159), E169 (= E183), D170 (= D184)
- binding 1-O-phosphono-alpha-D-galactopyranose: H20 (≠ S38), W24 (≠ L42), V47 (vs. gap), R49 (vs. gap), S116 (vs. gap), K117 (vs. gap), N118 (≠ S127)
- binding magnesium ion: D8 (= D26), D10 (= D28), E169 (= E183), D170 (= D184)
2wf9A Structure of beta-phosphoglucomutase inhibited with glucose-6- phosphate, and beryllium trifluoride, crystal form 2 (see paper)
28% identity, 73% coverage: 23:201/246 of query aligns to 5:187/221 of 2wf9A
- active site: D8 (= D26), L9 (≠ F27), D10 (= D28), T16 (≠ S34), K45 (≠ L63), S114 (= S126), A115 (vs. gap), K145 (= K159), E169 (= E183), D170 (= D184)
- binding beryllium trifluoride ion: D8 (= D26), L9 (≠ F27), D10 (= D28), S114 (= S126), A115 (vs. gap), K145 (= K159)
- binding 6-O-phosphono-beta-D-glucopyranose: D10 (= D28), H20 (≠ S38), G46 (= G64), V47 (vs. gap), R49 (vs. gap), S116 (vs. gap), K117 (vs. gap), N118 (≠ S127)
- binding 6-O-phosphono-alpha-D-glucopyranose: D10 (= D28), H20 (≠ S38), G46 (= G64), V47 (vs. gap), R49 (vs. gap), A115 (vs. gap), S116 (vs. gap), K117 (vs. gap), N118 (≠ S127)
- binding magnesium ion: D8 (= D26), D10 (= D28), D170 (= D184)
1o03A Structure of pentavalent phosphorous intermediate of an enzyme catalyzed phosphoryl transfer reaction observed on cocrystallization with glucose 6-phosphate (see paper)
28% identity, 73% coverage: 23:201/246 of query aligns to 5:187/221 of 1o03A
- active site: D8 (= D26), L9 (≠ F27), D10 (= D28), T16 (≠ S34), K45 (≠ L63), S114 (= S126), A115 (vs. gap), K145 (= K159), E169 (= E183), D170 (= D184)
- binding 1,6-di-O-phosphono-alpha-D-glucopyranose: D8 (= D26), L9 (≠ F27), D10 (= D28), H20 (≠ S38), G46 (= G64), V47 (vs. gap), R49 (vs. gap), S114 (= S126), A115 (vs. gap), S116 (vs. gap), K117 (vs. gap), K145 (= K159)
- binding magnesium ion: D8 (= D26), D10 (= D28), D170 (= D184)
1lvhA The structure of phosphorylated beta-phosphoglucomutase from lactoccocus lactis to 2.3 angstrom resolution (see paper)
28% identity, 73% coverage: 23:201/246 of query aligns to 5:187/221 of 1lvhA
- active site: D8 (= D26), L9 (≠ F27), D10 (= D28), T16 (≠ S34), K45 (≠ L63), S114 (= S126), A115 (vs. gap), K145 (= K159), E169 (= E183), D170 (= D184)
- binding magnesium ion: D8 (= D26), D10 (= D28), D170 (= D184)
6h91A Phosphorylated beta-phosphoglucomutase from lactococcus lactis in an open conformer to 2.4 a
28% identity, 73% coverage: 23:201/246 of query aligns to 5:187/218 of 6h91A
4c4rA Structure of beta-phosphoglucomutase in complex with a phosphonate analogue of beta-glucose-1-phosphate and magnesium trifluoride (see paper)
28% identity, 73% coverage: 23:201/246 of query aligns to 5:187/218 of 4c4rA
- active site: D8 (= D26), L9 (≠ F27), D10 (= D28), T16 (≠ S34), K45 (≠ L63), S114 (= S126), A115 (vs. gap), K145 (= K159), E169 (= E183), D170 (= D184)
- binding magnesium ion: D8 (= D26), D10 (= D28), D170 (= D184)
- binding trifluoromagnesate: D8 (= D26), L9 (≠ F27), D10 (= D28), S114 (= S126), A115 (vs. gap), K145 (= K159)
- binding (1R)-1,5-anhydro-1-(phosphonomethyl)-D-glucitol: D10 (= D28), H20 (≠ S38), W24 (≠ L42), L44 (≠ F62), G46 (= G64), V47 (vs. gap), R49 (vs. gap), S52 (= S66), S116 (vs. gap), K117 (vs. gap)
3zi4A The structure of beta-phosphoglucomutase inhibited with glucose-6- phosphate and scandium tetrafluoride
28% identity, 73% coverage: 23:201/246 of query aligns to 5:187/218 of 3zi4A
- active site: D8 (= D26), L9 (≠ F27), D10 (= D28), T16 (≠ S34), K45 (≠ L63), S114 (= S126), A115 (vs. gap), K145 (= K159), E169 (= E183), D170 (= D184)
- binding 6-O-phosphono-beta-D-glucopyranose: D10 (= D28), H20 (≠ S38), G46 (= G64), V47 (vs. gap), R49 (vs. gap), S116 (vs. gap), K117 (vs. gap)
- binding magnesium ion: D8 (= D26), D10 (= D28), D170 (= D184)
- binding Scandium Tetrafluoride: D8 (= D26), L9 (≠ F27), D10 (= D28), S114 (= S126), A115 (vs. gap), K145 (= K159)
2wf8A Structure of beta-phosphoglucomutase inhibited with glucose-6- phosphate, glucose-1-phosphate and beryllium trifluoride (see paper)
28% identity, 73% coverage: 23:201/246 of query aligns to 5:187/218 of 2wf8A
- active site: D8 (= D26), L9 (≠ F27), D10 (= D28), T16 (≠ S34), K45 (≠ L63), S114 (= S126), A115 (vs. gap), K145 (= K159), E169 (= E183), D170 (= D184)
- binding beryllium trifluoride ion: D8 (= D26), L9 (≠ F27), D10 (= D28), S114 (= S126), A115 (vs. gap), K145 (= K159)
- binding 6-O-phosphono-beta-D-glucopyranose: D10 (= D28), H20 (≠ S38), G46 (= G64), V47 (vs. gap), R49 (vs. gap), A115 (vs. gap), S116 (vs. gap), K117 (vs. gap)
- binding 1-O-phosphono-alpha-D-glucopyranose: D10 (= D28), H20 (≠ S38), W24 (≠ L42), L44 (≠ F62), G46 (= G64), V47 (vs. gap), R49 (vs. gap), S52 (= S66), A115 (vs. gap), S116 (vs. gap), K117 (vs. gap)
- binding magnesium ion: D8 (= D26), D10 (= D28), D170 (= D184)
2wf7A Structure of beta-phosphoglucomutase inhibited with glucose-6- phosphonate and aluminium tetrafluoride (see paper)
28% identity, 73% coverage: 23:201/246 of query aligns to 5:187/218 of 2wf7A
- active site: D8 (= D26), L9 (≠ F27), D10 (= D28), T16 (≠ S34), K45 (≠ L63), S114 (= S126), A115 (vs. gap), K145 (= K159), E169 (= E183), D170 (= D184)
- binding tetrafluoroaluminate ion: D8 (= D26), L9 (≠ F27), D10 (= D28), S114 (= S126), K145 (= K159)
- binding 6,7-dideoxy-7-phosphono-beta-D-gluco-heptopyranose: D10 (= D28), G46 (= G64), V47 (vs. gap), R49 (vs. gap), S116 (vs. gap), K117 (vs. gap), N118 (≠ S127)
- binding magnesium ion: D8 (= D26), D10 (= D28), D170 (= D184)
2wf6A Structure of beta-phosphoglucomutase inhibited with glucose-6- phosphate and aluminium tetrafluoride (see paper)
28% identity, 73% coverage: 23:201/246 of query aligns to 5:187/218 of 2wf6A
- active site: D8 (= D26), L9 (≠ F27), D10 (= D28), T16 (≠ S34), K45 (≠ L63), S114 (= S126), A115 (vs. gap), K145 (= K159), E169 (= E183), D170 (= D184)
- binding tetrafluoroaluminate ion: D8 (= D26), L9 (≠ F27), D10 (= D28), S114 (= S126), K145 (= K159)
- binding 6-O-phosphono-beta-D-glucopyranose: D10 (= D28), G46 (= G64), V47 (vs. gap), R49 (vs. gap), S116 (vs. gap), K117 (vs. gap)
- binding magnesium ion: D8 (= D26), D10 (= D28), D170 (= D184)
Query Sequence
>3607123 FitnessBrowser__Dino:3607123
MNTPRKLRLPQTCTDLFGDVDLVIFDFDGVIADSEVISLATLQASLKAFGMDLTIEEIRQ
KFLGKSLKTISTYVDQHSSSQAAADFGNAWQAELYSRFRAELKPLPHLEKLLFELAETAT
RFCIASSGTFERINVALSAMSMSDCFDHVFSSEQVSRGKPAPDLFLMAAEALDVSPSRCL
VIEDSLYGIRAAKAAGMRGVGFLGGAHLQGIVEQHGKTLLENGADMILASHQDIAARLAP
KRTQQN
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory