Comparing 3607125 FitnessBrowser__Dino:3607125 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5iaiA Crystal structure of abc transporter solute binding protein arad_9887 from agrobacterium radiobacter k84, target efi-510945 in complex with ribitol
27% identity, 83% coverage: 36:404/447 of query aligns to 2:370/399 of 5iaiA
6dtqA Maltose bound t. Maritima male3 (see paper)
28% identity, 85% coverage: 53:433/447 of query aligns to 16:391/391 of 6dtqA
Sites not aligning to the query:
Q7LYW7 Trehalose/maltose-binding protein MalE; TMBP from Thermococcus litoralis (strain ATCC 51850 / DSM 5473 / JCM 8560 / NS-C) (see paper)
25% identity, 76% coverage: 93:433/447 of query aligns to 103:446/450 of Q7LYW7
Sites not aligning to the query:
1eu8A Structure of trehalose maltose binding protein from thermococcus litoralis (see paper)
25% identity, 76% coverage: 93:433/447 of query aligns to 62:405/407 of 1eu8A
Sites not aligning to the query:
5ci5A Crystal structure of an abc transporter solute binding protein from thermotoga lettingae tmo (tlet_1705, target efi-510544) bound with alpha-d-tagatose
27% identity, 86% coverage: 53:435/447 of query aligns to 17:393/393 of 5ci5A
Sites not aligning to the query:
4ryaA Crystal structure of abc transporter solute binding protein avi_3567 from agrobacterium vitis s4, target efi-510645, with bound d-mannitol
25% identity, 81% coverage: 78:438/447 of query aligns to 40:415/417 of 4ryaA
6jaiA Crystal structure of abc transporter alpha-glycoside-binding mutant protein d118a in complex with maltose (see paper)
23% identity, 85% coverage: 55:433/447 of query aligns to 20:399/404 of 6jaiA
Sites not aligning to the query:
6jahA Crystal structure of abc transporter alpha-glycoside-binding protein in complex with glucose (see paper)
23% identity, 85% coverage: 55:433/447 of query aligns to 20:399/404 of 6jahA
6jagA Crystal structure of abc transporter alpha-glycoside-binding protein in complex with sucrose (see paper)
23% identity, 85% coverage: 55:433/447 of query aligns to 20:399/404 of 6jagA
Sites not aligning to the query:
6jadA Crystal structure of abc transporter alpha-glycoside-binding protein in complex with palatinose (see paper)
23% identity, 85% coverage: 55:433/447 of query aligns to 20:399/404 of 6jadA
Sites not aligning to the query:
6j9yA Crystal structure of abc transporter alpha-glycoside-binding protein in complex with maltose (see paper)
23% identity, 85% coverage: 55:433/447 of query aligns to 20:399/404 of 6j9yA
Sites not aligning to the query:
6jb0A Crystal structure of abc transporter alpha-glycoside-binding mutant protein w287a in complex with trehalose (see paper)
23% identity, 85% coverage: 55:433/447 of query aligns to 20:399/404 of 6jb0A
Sites not aligning to the query:
6jamA Crystal structure of abc transporter alpha-glycoside-binding mutant protein r356a in complex with trehalose (see paper)
23% identity, 85% coverage: 55:433/447 of query aligns to 22:401/406 of 6jamA
Sites not aligning to the query:
8artB Abc transporter binding protein male from streptomyces scabiei in complex with maltose
26% identity, 80% coverage: 50:408/447 of query aligns to 19:357/393 of 8artB
Sites not aligning to the query:
4qsdA Crystal structure of atu4361 sugar transporter from agrobacterium fabrum c58, target efi-510558, with bound sucrose
23% identity, 82% coverage: 65:432/447 of query aligns to 27:381/382 of 4qsdA
Sites not aligning to the query:
4qrzA Crystal structure of sugar transporter atu4361 from agrobacterium fabrum c58, target efi-510558, with bound maltotriose
23% identity, 82% coverage: 65:432/447 of query aligns to 27:381/383 of 4qrzA
Sites not aligning to the query:
7ofyA Crystal structure of sq binding protein from agrobacterium tumefaciens in complex with sulfoquinovosyl glycerol (sqgro) (see paper)
24% identity, 86% coverage: 49:433/447 of query aligns to 19:387/389 of 7ofyA
Sites not aligning to the query:
A9CEY9 Sulfoquinovosyl glycerol-binding protein SmoF; SQGro-binding protein SmoF; SQ monooxygenase cluster protein F from Agrobacterium fabrum (strain C58 / ATCC 33970) (Agrobacterium tumefaciens (strain C58)) (see 2 papers)
24% identity, 86% coverage: 49:433/447 of query aligns to 47:415/416 of A9CEY9
Sites not aligning to the query:
7yzuA Crystal structure of the sulfoquinovosyl binding protein smof complexed with sqme (see paper)
24% identity, 86% coverage: 49:433/447 of query aligns to 16:382/382 of 7yzuA
Sites not aligning to the query:
3k02A Crystal structures of the gach receptor of streptomyces glaucescens gla.O in the unliganded form and in complex with acarbose and an acarbose homolog. Comparison with acarbose-loaded maltose binding protein of salmonella typhimurium. (see paper)
23% identity, 85% coverage: 56:433/447 of query aligns to 21:384/388 of 3k02A
Sites not aligning to the query:
>3607125 FitnessBrowser__Dino:3607125
MKTLRNLLCSAAVASVMASGAMADGHGWSLKDAAAPYAGTTVDVVFLLRPGYEAIEAMLP
AFEEETGIKVNVIKHPYENALGEQVRDFVAGGDLDVALIDLVWIGSFAENEWILPLADVQ
AKFPDAVDPDLDIDDFFPLVLNAFGGWNDTIYGLPFDNYSGLMFYNRCMLEEAGFDGPPS
TWEELKDVYGPALTKDGKYAFALQSKRNETQSADSFARMLWPFGGSFLNEEFRSNLMSEG
SQAGLKFRQELMEYMPDGIVAYDHAETVNAFSQGDVAMITEWSAFYSSVVSPETSRVADC
VEIAPEPMGPAGRKPALGGFSLAVASQADEAEQAAAYLFIQWATSKANAREYLERGGVPA
RQSVYQQDGLEEFKFVPALVESWQDGVPEFRPRFAEWPEITEIVQEWGTKMMLGEVTTEE
GAQEIGTRMEEVLDAAGYYSGEKPLAQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory