SitesBLAST
Comparing 3607129 FitnessBrowser__Dino:3607129 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P27867 Sorbitol dehydrogenase; SDH; L-iditol 2-dehydrogenase; Polyol dehydrogenase; Xylitol dehydrogenase; XDH; EC 1.1.1.-; EC 1.1.1.14; EC 1.1.1.9 from Rattus norvegicus (Rat) (see paper)
41% identity, 98% coverage: 4:343/347 of query aligns to 11:349/357 of P27867
3qe3A Sheep liver sorbitol dehydrogenase (see paper)
42% identity, 98% coverage: 4:343/347 of query aligns to 5:343/351 of 3qe3A
- active site: C39 (= C39), G40 (= G40), S41 (= S41), H44 (= H44), H64 (= H64), E65 (= E65), R94 (≠ N94), D97 (≠ S97), C100 (≠ S100), S108 (≠ D108), F112 (≠ Q112), P151 (= P151), G155 (= G155), K339 (= K339)
- binding glycerol: Y45 (= Y45), F54 (= F54), T116 (= T116), R293 (= R291)
- binding zinc ion: C39 (= C39), H64 (= H64), E65 (= E65)
1pl6A Human sdh/nadh/inhibitor complex (see paper)
42% identity, 94% coverage: 4:328/347 of query aligns to 10:335/356 of 1pl6A
- active site: C44 (= C39), G45 (= G40), S46 (= S41), H49 (= H44), H69 (= H64), E70 (= E65), R99 (≠ N94), D102 (≠ S97), C105 (≠ S100), S113 (≠ D108), F117 (≠ Q112), P156 (= P151), G160 (= G155)
- binding 4-[2-(hydroxymethyl)pyrimidin-4-yl]-n,n-dimethylpiperazine-1-sulfonamide: C44 (= C39), S46 (= S41), I56 (= I51), F59 (= F54), H69 (= H64), E155 (= E150), L274 (≠ M267), F297 (= F290)
- binding nicotinamide-adenine-dinucleotide: G181 (= G176), P182 (= P177), I183 (= I178), D203 (= D198), L204 (= L199), R208 (≠ K203), C249 (= C242), T250 (≠ A243), V272 (= V265), G273 (= G266), L274 (≠ M267), F297 (= F290), R298 (= R291)
- binding zinc ion: C44 (= C39), H69 (= H64)
Sites not aligning to the query:
Q00796 Sorbitol dehydrogenase; SDH; (R,R)-butanediol dehydrogenase; L-iditol 2-dehydrogenase; Polyol dehydrogenase; Ribitol dehydrogenase; RDH; Xylitol dehydrogenase; XDH; EC 1.1.1.-; EC 1.1.1.4; EC 1.1.1.14; EC 1.1.1.56; EC 1.1.1.9 from Homo sapiens (Human) (see 10 papers)
42% identity, 94% coverage: 4:328/347 of query aligns to 11:336/357 of Q00796
- C45 (= C39) binding
- H70 (= H64) binding
- E71 (= E65) binding
- R110 (≠ V104) to P: in SORDD; results in protein aggregation
- H135 (= H129) to R: in SORDD; results in protein aggregation
- A153 (= A147) to D: in SORDD; uncertain significance; results in protein aggregation; dbSNP:rs145813597
- I184 (= I178) binding
- D204 (= D198) binding
- R209 (≠ K203) binding
- Q239 (≠ T231) to L: in dbSNP:rs1042079
- N269 (≠ C261) to T: in dbSNP:rs930337
- VGL 273:275 (≠ VGM 265:267) binding
- VFR 297:299 (= VFR 289:291) binding
- V322 (≠ I314) to I: in SORDD; uncertain significance; dbSNP:rs149975952
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
P07846 Sorbitol dehydrogenase; SDH; L-iditol 2-dehydrogenase; Polyol dehydrogenase; Xylitol dehydrogenase; XDH; EC 1.1.1.-; EC 1.1.1.14; EC 1.1.1.9 from Ovis aries (Sheep) (see paper)
42% identity, 98% coverage: 4:343/347 of query aligns to 9:346/354 of P07846
- C43 (= C39) binding
- Y49 (= Y45) binding
- H67 (= H64) binding
- E68 (= E65) binding
- E153 (= E150) binding
- R296 (= R291) binding
- Y297 (= Y292) binding
1e3jA Ketose reductase (sorbitol dehydrogenase) from silverleaf whitefly (see paper)
38% identity, 95% coverage: 12:342/347 of query aligns to 14:344/348 of 1e3jA
- active site: C38 (= C39), G39 (= G40), S40 (= S41), H43 (= H44), H63 (= H64), E64 (= E65), C93 (≠ N94), C96 (≠ S97), C99 (≠ S100), C107 (≠ D108), T111 (≠ Q112), P150 (= P151), G154 (= G155), K341 (= K339)
- binding phosphate ion: A174 (= A175), A196 (≠ D198), R197 (≠ L199), S198 (≠ V200), R201 (≠ K203)
- binding zinc ion: C38 (= C39), H63 (= H64), E64 (= E65), C93 (≠ N94), C96 (≠ S97), C99 (≠ S100), C107 (≠ D108)
7y9pA Xylitol dehydrogenase s96c/s99c/y102c mutant(thermostabilized form) from pichia stipitis (see paper)
37% identity, 94% coverage: 4:328/347 of query aligns to 5:341/357 of 7y9pA
5vm2A Crystal structure of eck1772, an oxidoreductase/dehydrogenase of unknown specificity involved in membrane biogenesis from escherichia coli
37% identity, 96% coverage: 12:344/347 of query aligns to 15:345/347 of 5vm2A
- active site: C39 (= C39), G40 (= G40), S41 (= S41), H44 (= H44), H65 (= H64), E66 (= E65), C95 (≠ N94), C98 (≠ S97), C101 (≠ S100), C109 (≠ D108), D113 (≠ Q112), P153 (= P151), G157 (= G155), K340 (= K339)
- binding magnesium ion: H65 (= H64), E66 (= E65), E152 (= E150)
- binding zinc ion: C95 (≠ N94), C98 (≠ S97), C101 (≠ S100), C109 (≠ D108)
Q7SI09 L-arabinitol 4-dehydrogenase; LAD; EC 1.1.1.12 from Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) (see 2 papers)
34% identity, 95% coverage: 14:343/347 of query aligns to 28:360/363 of Q7SI09
- C53 (= C39) binding
- F59 (≠ Y45) mutation F->A,S,Y: No effect.
- H78 (= H64) binding
- E79 (= E65) binding
- C108 (≠ N94) binding
- C111 (≠ S97) binding
- C114 (≠ S100) binding
- C122 (≠ D108) binding
- E163 (= E150) binding
- PI 190:191 (= PI 177:178) binding
- D211 (= D198) binding
- DI 211:212 (≠ DL 198:199) mutation to SR: Alters cofactor specificity from NAD to NADP; when associated with T-348.
- R216 (≠ K203) binding
- I282 (≠ V265) binding
- QYR 306:308 (≠ VFR 289:291) binding
- S348 (≠ V331) mutation to T: Alters cofactor specificity from NAD to NADP; when associated with 211-SR-212.
3m6iA L-arabinitol 4-dehydrogenase (see paper)
34% identity, 95% coverage: 14:343/347 of query aligns to 24:356/358 of 3m6iA
- active site: C49 (= C39), G50 (= G40), S51 (= S41), H54 (= H44), H74 (= H64), E75 (= E65), C104 (≠ N94), C107 (≠ S97), C110 (≠ S100), C118 (≠ D108), D122 (≠ Q112), P160 (= P151), A164 (≠ G155), K352 (= K339)
- binding nicotinamide-adenine-dinucleotide: C49 (= C39), V163 (≠ I154), G185 (= G176), P186 (= P177), I187 (= I178), D207 (= D198), R212 (≠ K203), C255 (= C242), T256 (≠ A243), I278 (≠ V265), G279 (= G266), V280 (≠ M267), R304 (= R291)
- binding zinc ion: C49 (= C39), H74 (= H64), C104 (≠ N94), C107 (≠ S97), C110 (≠ S100), C118 (≠ D108)
Q96V44 L-arabinitol 4-dehydrogenase; LAD; EC 1.1.1.12 from Hypocrea jecorina (Trichoderma reesei) (see paper)
35% identity, 93% coverage: 23:343/347 of query aligns to 50:374/377 of Q96V44
- DI 224:225 (≠ DL 198:199) mutation to SR: Alters cofactor specificity from NAD to NADP; when associated with T-362.
- A362 (≠ V331) mutation to T: Alters cofactor specificity from NAD to NADP; when associated with 224-SR-225.
A2QAC0 L-arabinitol 4-dehydrogenase; LAD; EC 1.1.1.12 from Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513) (see 2 papers)
32% identity, 99% coverage: 1:342/347 of query aligns to 1:370/386 of A2QAC0
- M70 (≠ F54) mutation to F: Abolishes enzyme activity.
- DI 213:214 (≠ DL 198:199) mutation to SR: Alters cofactor specificity from NAD to NADP; when associated with T-359.
- Y318 (≠ F290) mutation to F: Increases affinity for D-sorbitol.
- A359 (≠ V331) mutation to T: Alters cofactor specificity from NAD to NADP; when associated with 213-SR-214.
B6HI95 L-arabinitol 4-dehydrogenase; LAD; EC 1.1.1.12 from Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) (Penicillium chrysogenum) (see paper)
33% identity, 94% coverage: 16:342/347 of query aligns to 31:369/385 of B6HI95
- DI 212:213 (≠ DL 198:199) mutation to SR: Alters cofactor specificity from NAD to NADP; when associated with T-358.
- S358 (≠ V331) mutation to T: Alters cofactor specificity from NAD to NADP; when associated with 212-SR-213.
P07913 L-threonine 3-dehydrogenase; TDH; L-threonine dehydrogenase; EC 1.1.1.103 from Escherichia coli (strain K12) (see paper)
30% identity, 93% coverage: 7:328/347 of query aligns to 7:326/341 of P07913
- C38 (= C39) mutation to D: Shows only 1% of wild-type catalytic activity. This mutant can be stimulated to the wild-type activity level after incubation with Zn(+).; mutation to S: Loss of catalytic activity. This mutant cannot be stimulated to the wild-type activity level after incubation with Zn(+).
2ejvA Crystal structure of threonine 3-dehydrogenase complexed with NAD+
31% identity, 91% coverage: 13:327/347 of query aligns to 13:326/343 of 2ejvA
- active site: C38 (= C39), G39 (= G40), T40 (≠ S41), H43 (= H44), H63 (= H64), E64 (= E65), C93 (≠ N94), C96 (≠ S97), C99 (≠ S100), C107 (≠ D108), Q111 (= Q112), P149 (= P151), A153 (≠ G155)
- binding nicotinamide-adenine-dinucleotide: G172 (= G174), G174 (= G176), P175 (= P177), I176 (= I178), S195 (= S197), D196 (= D198), P197 (≠ L199), R201 (≠ K203), F238 (≠ C242), S239 (≠ A243), N241 (≠ A245), A244 (≠ S248), L261 (≠ V265), G262 (= G266), I263 (≠ M267)
- binding zinc ion: C38 (= C39), H63 (= H64), E64 (= E65), C96 (≠ S97), C99 (≠ S100), C107 (≠ D108)
Sites not aligning to the query:
2dq4A Crystal structure of threonine 3-dehydrogenase
31% identity, 91% coverage: 13:327/347 of query aligns to 13:326/343 of 2dq4A
- active site: C38 (= C39), G39 (= G40), T40 (≠ S41), H43 (= H44), H63 (= H64), E64 (= E65), C93 (≠ N94), C96 (≠ S97), C99 (≠ S100), C107 (≠ D108), Q111 (= Q112), P149 (= P151), A153 (≠ G155)
- binding zinc ion: C38 (= C39), H63 (= H64), E64 (= E65), C93 (≠ N94), C96 (≠ S97), C107 (≠ D108)
Sites not aligning to the query:
Q5SKS4 L-threonine 3-dehydrogenase; TDH; EC 1.1.1.103 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
31% identity, 91% coverage: 13:327/347 of query aligns to 13:326/343 of Q5SKS4
- C38 (= C39) binding
- H63 (= H64) binding
- E64 (= E65) binding
- C93 (≠ N94) binding
- C96 (≠ S97) binding
- C99 (≠ S100) binding
- C107 (≠ D108) binding
- I176 (= I178) binding
- D196 (= D198) binding
- R201 (≠ K203) binding
- LGI 261:263 (≠ VGM 265:267) binding
- IAG 286:288 (vs. gap) binding
6dkhC The crystal structure of l-idonate 5-dehydrogenase from escherichia coli str. K-12 substr. Mg1655
30% identity, 84% coverage: 31:322/347 of query aligns to 35:325/346 of 6dkhC
4cpdA Alcohol dehydrogenase tadh from thermus sp. Atn1
29% identity, 94% coverage: 3:329/347 of query aligns to 2:335/346 of 4cpdA
- active site: C38 (= C39), G39 (= G40), S40 (= S41), H43 (= H44), H59 (= H64), E60 (= E65), C89 (≠ N94), C92 (≠ S97), C95 (≠ S100), C103 (≠ D108), G107 (≠ Q112), D152 (≠ E150), T156 (≠ I154)
- binding nicotinamide-adenine-dinucleotide: G39 (= G40), S40 (= S41), T156 (≠ I154), G178 (= G176), P179 (= P177), V180 (≠ I178), D200 (= D198), R201 (≠ L199), R205 (≠ K203), A243 (≠ C242), V244 (≠ A243), V266 (= V265), V268 (≠ M267), L292 (≠ F290), A293 (≠ R291), F333 (= F327)
- binding zinc ion: C38 (= C39), H59 (= H64), C89 (≠ N94), C92 (≠ S97), C95 (≠ S100), C103 (≠ D108), D152 (≠ E150)
Sites not aligning to the query:
4ej6A Crystal structure of a putative zinc-binding dehydrogenase (target psi-012003) from sinorhizobium meliloti 1021
29% identity, 93% coverage: 1:323/347 of query aligns to 3:323/343 of 4ej6A
- active site: C40 (= C39), G41 (= G40), T42 (≠ S41), H45 (= H44), H61 (= H64), E62 (= E65), C91 (≠ N94), C94 (≠ S97), C97 (≠ S100), C105 (≠ D108), R109 (≠ Q112), P147 (= P151), C151 (≠ G155)
- binding zinc ion: C91 (≠ N94), C94 (≠ S97), C97 (≠ S100), C105 (≠ D108)
Sites not aligning to the query:
Query Sequence
>3607129 FitnessBrowser__Dino:3607129
MARALVLEAARKLALRDIDLPDELGPEDVRIAIDTVGVCGSDVHYYTHGKIGPFVVKQPM
VLGHEAAGIVTEIGAAVTHLALGDRVCMEPGIPNGSSKASKLGVYNVDPAVQFWATPPVH
GCLTPSVVHPAAFTFKLPDHVSFAEGAMVEPFAIGMQAAAKARIKPGDVALVTGAGPIGV
MVALAALAGGCAKVFVSDLVEDKLAIAAGYDNIHPILIPRDNPAEVLQEATEGWGADVVF
ECAGAAASIQAALEAAAPAGCVVWVGMPVDPVPVDIVLAQSRELRMETVFRYANMYDRAI
ALLASGKVDLKPLISATFPFEDSIAAFDRAVEARPTDVKIQIKMGAS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory