SitesBLAST
Comparing 3607131 FitnessBrowser__Dino:3607131 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3uf0A Crystal structure of a putative NAD(p) dependent gluconate 5- dehydrogenase from beutenbergia cavernae(efi target efi-502044) with bound NADP (low occupancy)
39% identity, 96% coverage: 7:252/255 of query aligns to 3:246/249 of 3uf0A
- active site: G18 (= G22), S141 (= S147), V151 (≠ H157), Y154 (= Y160), K158 (= K164)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G14 (= G18), S17 (= S21), G18 (= G22), I19 (= I23), R39 (= R43), D63 (= D68), L64 (= L69), N89 (≠ S95), G91 (= G97), I92 (= I98), I139 (= I145), A140 (≠ S146), S141 (= S147), Y154 (= Y160), K158 (= K164), P184 (= P190), G185 (≠ T191), V187 (= V193), T189 (= T195), N191 (≠ M197), T192 (≠ G198)
3o03A Quaternary complex structure of gluconate 5-dehydrogenase from streptococcus suis type 2 (see paper)
40% identity, 97% coverage: 5:251/255 of query aligns to 5:245/254 of 3o03A
- active site: G22 (= G22), S147 (= S147), V157 (≠ H157), Y160 (= Y160), K164 (= K164)
- binding calcium ion: S147 (= S147), M148 (≠ Q148), P190 (= P190)
- binding D-gluconic acid: I99 (≠ A99), R101 (≠ T101), S147 (= S147), M149 (≠ T149), R154 (≠ L154), Y160 (= Y160)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G18 (= G18), Y21 (≠ S21), G22 (= G22), I23 (= I23), D42 (= D44), I43 (≠ L45), L47 (= L48), D68 (= D68), V69 (≠ L69), N95 (≠ S95), A96 (= A96), G97 (= G97), I145 (= I145), Y160 (= Y160), K164 (= K164), P190 (= P190)
5u9pB Crystal structure of a gluconate 5-dehydrogenase from burkholderia cenocepacia j2315 in complex with NADP and tartrate
37% identity, 98% coverage: 5:254/255 of query aligns to 10:259/261 of 5u9pB
- active site: G27 (= G22), S152 (= S147), Y165 (= Y160), K169 (= K164)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G23 (= G18), R26 (≠ S21), G27 (= G22), I28 (= I23), R48 (= R43), D73 (= D68), V74 (≠ L69), N100 (≠ S95), A101 (= A96), I150 (= I145), Y165 (= Y160), K169 (= K164), P195 (= P190), F198 (≠ V193), T200 (= T195), L202 (≠ M197), N203 (≠ G198)
5itvA Crystal structure of bacillus subtilis bacc dihydroanticapsin 7- dehydrogenase in complex with nadh (see paper)
34% identity, 97% coverage: 7:254/255 of query aligns to 3:254/255 of 5itvA
- active site: G18 (= G22), S141 (= S147), Y154 (= Y160), K158 (= K164)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G18), S17 (= S21), G18 (= G22), I19 (= I23), D38 (= D44), I39 (≠ L45), T61 (≠ G67), I63 (≠ L69), N89 (≠ S95), G91 (= G97), T139 (≠ I145), S141 (= S147), Y154 (= Y160), K158 (= K164), P184 (= P190), G185 (≠ T191), I186 (≠ V192), I187 (≠ V193)
3op4A Crystal structure of putative 3-ketoacyl-(acyl-carrier-protein) reductase from vibrio cholerae o1 biovar eltor str. N16961 in complex with NADP+ (see paper)
36% identity, 98% coverage: 7:255/255 of query aligns to 4:247/247 of 3op4A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G18), S17 (= S20), R18 (≠ S21), I20 (= I23), T40 (≠ R43), N62 (≠ D68), V63 (≠ L69), N89 (≠ S95), A90 (= A96), I92 (= I98), V139 (≠ I145), S141 (= S147), Y154 (= Y160), K158 (= K164), P184 (= P190), G185 (≠ T191), I187 (≠ V193), T189 (= T195), M191 (= M197)
4i08A Crystal structure of beta-ketoacyl-acyl carrier protein reductase (fabg) from vibrio cholerae in complex with NADPH (see paper)
36% identity, 98% coverage: 7:255/255 of query aligns to 4:243/243 of 4i08A
- active site: G19 (= G22), N113 (= N119), S141 (= S147), Q151 (≠ H157), Y154 (= Y160), K158 (= K164)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G15 (= G18), S17 (= S20), R18 (≠ S21), I20 (= I23), T40 (≠ R43), N62 (≠ D68), V63 (≠ L69), N89 (≠ S95), A90 (= A96), G140 (≠ S146), S141 (= S147), Y154 (= Y160), K158 (= K164), P184 (= P190), G185 (≠ T191), T189 (= T195)
3d3wA Structure of l-xylulose reductase with bound coenzyme, phosphate and hydroxide. (see paper)
35% identity, 96% coverage: 9:252/255 of query aligns to 5:241/244 of 3d3wA
- active site: G18 (= G22), S136 (= S147), H146 (= H157), Y149 (= Y160), K153 (= K164)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G14 (= G18), G16 (≠ S20), K17 (≠ S21), G18 (= G22), I19 (= I23), S38 (≠ G42), R39 (= R43), T40 (vs. gap), V59 (≠ G67), L61 (= L69), N83 (≠ S95), A84 (= A96), A85 (≠ G97), V106 (= V118), V134 (≠ I145), S135 (= S146), S136 (= S147), Y149 (= Y160), K153 (= K164), P179 (= P190), T180 (= T191), V182 (= V193), T184 (= T195), S185 (≠ E196), M186 (= M197), G187 (= G198)
1pr9A Human l-xylulose reductase holoenzyme (see paper)
35% identity, 96% coverage: 9:252/255 of query aligns to 5:241/244 of 1pr9A
- active site: G18 (= G22), S136 (= S147), H146 (= H157), Y149 (= Y160), K153 (= K164)
- binding dihydrogenphosphate ion: S136 (= S147), C138 (≠ T149)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G14 (= G18), G16 (≠ S20), K17 (≠ S21), G18 (= G22), I19 (= I23), S38 (≠ G42), R39 (= R43), T40 (vs. gap), L61 (= L69), N83 (≠ S95), A85 (≠ G97), V106 (= V118), V134 (≠ I145), Y149 (= Y160), K153 (= K164), T180 (= T191), V182 (= V193), T184 (= T195), M186 (= M197)
Q7Z4W1 L-xylulose reductase; XR; Carbonyl reductase II; Dicarbonyl/L-xylulose reductase; Kidney dicarbonyl reductase; kiDCR; Short chain dehydrogenase/reductase family 20C member 1; Sperm surface protein P34H; EC 1.1.1.10 from Homo sapiens (Human) (see 2 papers)
35% identity, 96% coverage: 9:252/255 of query aligns to 5:241/244 of Q7Z4W1
- 11:40 (vs. 15:43, 43% identical) binding
- N107 (= N119) mutation N->L,D: Loss of function. Probably due to defects in formation of the active site and binding of coenzyme.
- S136 (= S147) binding
- K153 (= K164) binding
Sites not aligning to the query:
- 1 modified: N-acetylmethionine
P50163 Tropinone reductase 2; Tropinone reductase II; TR-II; EC 1.1.1.236 from Datura stramonium (Jimsonweed) (Common thornapple) (see paper)
34% identity, 96% coverage: 6:251/255 of query aligns to 4:253/260 of P50163
- 18:41 (vs. 20:43, 42% identical) binding
- S146 (= S147) binding
- IATSL 192:196 (≠ VLTEM 193:197) binding
2ae2A Tropinone reductase-ii complexed with NADP+ and pseudotropine (see paper)
34% identity, 96% coverage: 6:251/255 of query aligns to 3:252/259 of 2ae2A
- active site: G19 (= G22), S145 (= S147), Y158 (= Y160), K162 (= K164)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G18), S17 (= S20), R18 (≠ S21), G19 (= G22), I20 (= I23), S39 (≠ G42), R40 (= R43), C64 (≠ G67), L66 (= L69), N93 (≠ S95), G95 (= G97), I116 (≠ V118), I143 (= I145), S145 (= S147), Y158 (= Y160), K162 (= K164), P188 (= P190), G189 (≠ T191), V190 (= V192), I191 (≠ V193), T193 (= T195), S194 (≠ E196), L195 (≠ M197), V196 (≠ G198)
- binding pseudotropine: S145 (= S147), E155 (≠ H157), Y158 (= Y160), L195 (≠ M197)
1ipfA Tropinone reductase-ii complexed with NADPH and tropinone (see paper)
34% identity, 96% coverage: 6:251/255 of query aligns to 3:252/259 of 1ipfA
- active site: G19 (= G22), S145 (= S147), Y158 (= Y160), K162 (= K164)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G15 (= G18), R18 (≠ S21), G19 (= G22), I20 (= I23), S39 (≠ G42), R40 (= R43), C64 (≠ G67), D65 (= D68), L66 (= L69), N93 (≠ S95), S145 (= S147), Y158 (= Y160), K162 (= K164), P188 (= P190), V190 (= V192), I191 (≠ V193), T193 (= T195), S194 (≠ E196), L195 (≠ M197), V196 (≠ G198)
- binding 8-methyl-8-azabicyclo[3,2,1]octan-3-one: S147 (≠ T149), E155 (≠ H157), Y158 (= Y160)
1ipeA Tropinone reductase-ii complexed with NADPH (see paper)
34% identity, 96% coverage: 6:251/255 of query aligns to 3:252/259 of 1ipeA
- active site: G19 (= G22), S145 (= S147), Y158 (= Y160), K162 (= K164)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G15 (= G18), S17 (= S20), R18 (≠ S21), G19 (= G22), I20 (= I23), S39 (≠ G42), R40 (= R43), C64 (≠ G67), D65 (= D68), L66 (= L69), N93 (≠ S95), I116 (≠ V118), S145 (= S147), Y158 (= Y160), K162 (= K164), P188 (= P190), I191 (≠ V193), T193 (= T195), S194 (≠ E196), L195 (≠ M197), V196 (≠ G198)
5yssB Crystal structure of aminocaproic acid cyclase in complex with NAD (+) (see paper)
37% identity, 96% coverage: 8:252/255 of query aligns to 1:252/255 of 5yssB
- binding nicotinamide-adenine-dinucleotide: G11 (= G18), T13 (≠ S20), S14 (= S21), G15 (= G22), I16 (= I23), G35 (= G42), F36 (≠ R43), L60 (= L69), N86 (≠ S95), G88 (= G97), I89 (= I98), A137 (≠ S146), Y151 (= Y160), K155 (= K164), P181 (= P190), G182 (≠ T191), V184 (= V193), T186 (= T195)
6t77A Crystal structure of klebsiella pneumoniae fabg(NADPH-dependent) NADP- complex at 1.75 a resolution (see paper)
36% identity, 96% coverage: 7:251/255 of query aligns to 1:240/244 of 6t77A
- active site: G16 (= G22), S138 (= S147), Y151 (= Y160)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G18), S14 (= S20), R15 (≠ S21), T37 (≠ L48), L58 (≠ G67), N59 (≠ D68), V60 (≠ L69), A87 (= A96), G88 (= G97), I89 (= I98)
6ixmC Crystal structure of the ketone reductase chkred20 from the genome of chryseobacterium sp. Ca49 complexed with NAD (see paper)
31% identity, 97% coverage: 9:255/255 of query aligns to 3:248/248 of 6ixmC
- active site: G16 (= G22), S142 (= S147), Y155 (= Y160), K159 (= K164)
- binding nicotinamide-adenine-dinucleotide: G12 (= G18), S15 (= S21), G16 (= G22), I17 (= I23), D36 (≠ G42), I37 (≠ R43), A61 (≠ G67), D62 (= D68), T63 (≠ L69), N89 (≠ S95), A90 (= A96), M140 (≠ I145), S142 (= S147), Y155 (= Y160), K159 (= K164), P185 (= P190), A186 (≠ T191), Y187 (≠ V192), I188 (≠ V193), L192 (≠ M197)
4nbuB Crystal structure of fabg from bacillus sp (see paper)
38% identity, 95% coverage: 9:251/255 of query aligns to 5:241/244 of 4nbuB
- active site: G18 (= G22), N111 (= N119), S139 (= S147), Q149 (≠ H157), Y152 (= Y160), K156 (= K164)
- binding acetoacetyl-coenzyme a: D93 (≠ T101), K98 (≠ N106), S139 (= S147), N146 (≠ L154), V147 (≠ K155), Q149 (≠ H157), Y152 (= Y160), F184 (≠ V192), M189 (= M197), K200 (≠ P210)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G18), N17 (≠ S21), G18 (= G22), I19 (= I23), D38 (= D44), F39 (≠ L45), V59 (≠ G67), D60 (= D68), V61 (≠ L69), N87 (≠ S95), A88 (= A96), G89 (= G97), I90 (= I98), T137 (≠ I145), S139 (= S147), Y152 (= Y160), K156 (= K164), P182 (= P190), F184 (≠ V192), T185 (≠ V193), T187 (= T195), M189 (= M197)
5itvD Crystal structure of bacillus subtilis bacc dihydroanticapsin 7- dehydrogenase in complex with nadh (see paper)
33% identity, 97% coverage: 7:254/255 of query aligns to 3:226/227 of 5itvD
- active site: G18 (= G22), S141 (= S147), Y154 (= Y160), K158 (= K164)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G18), S17 (= S21), G18 (= G22), I19 (= I23), D38 (= D44), I39 (≠ L45), T61 (≠ G67), D62 (= D68), I63 (≠ L69), N89 (≠ S95), T139 (≠ I145), S141 (= S147), Y154 (= Y160), K158 (= K164), P184 (= P190), G185 (≠ T191), I187 (≠ V193)
Q9ZW19 Tropinone reductase homolog At2g29360; EC 1.1.1.- from Arabidopsis thaliana (Mouse-ear cress) (see paper)
33% identity, 97% coverage: 6:253/255 of query aligns to 13:261/271 of Q9ZW19
- S209 (≠ L201) mutation to Y: Loss of activity with quinuclidinone and decreased activity with cyclohexanones.
1vl8B Crystal structure of gluconate 5-dehydrogenase (tm0441) from thermotoga maritima at 2.07 a resolution
32% identity, 97% coverage: 7:254/255 of query aligns to 2:251/252 of 1vl8B
- active site: G17 (= G22), S143 (= S147), I154 (≠ H157), Y157 (= Y160), K161 (= K164)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G18), R16 (≠ S21), G17 (= G22), L18 (≠ I23), S37 (≠ G42), R38 (= R43), C63 (≠ G67), D64 (= D68), V65 (≠ L69), A91 (≠ S95), A92 (= A96), G93 (= G97), I94 (= I98), V114 (= V118), I141 (= I145), S143 (= S147), Y157 (= Y160), K161 (= K164), P187 (= P190), G188 (≠ T191), Y190 (≠ V193), T192 (= T195), M194 (= M197), T195 (≠ G198)
Query Sequence
>3607131 FitnessBrowser__Dino:3607131
MPWQDRFSLQDKTALVTGASSGIGRAIAEVFADAGADIVGQGRDLDRLTDLGAQIKTTGR
QFAAITGDLADPDQTQNVADRALAAFGKIDILVNSAGIAVTGPVTNYDLDDWQRTLAVNL
TAPFILSKAVMPGMMQRKQGKIINISSQTGVIALKDHAAYATSKGGLNALTKSLMTEAAP
HNVQVNAICPTVVLTEMGKELWSAPERKDPFIARTPLGRFGEPIEIADMALYLASPASDL
VNGAVMMIEGGYSSI
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory