SitesBLAST
Comparing 3607136 FitnessBrowser__Dino:3607136 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4yshB Crystal structure of glycine oxidase from geobacillus kaustophilus
24% identity, 76% coverage: 98:417/419 of query aligns to 51:368/368 of 4yshB
- active site: Q52 (≠ E99), I262 (≠ V312), L283 (≠ V333), G305 (= G355), N335 (≠ L384), L338 (≠ T387)
- binding flavin-adenine dinucleotide: V178 (≠ T223), S206 (≠ M254), W209 (≠ Y257), R307 (= R357), H332 (= H381), R334 (≠ T383), N335 (≠ L384), G336 (= G385), I337 (≠ W386), L338 (≠ T387)
- binding glycine: G249 (≠ H299), Y251 (≠ V301), Y251 (≠ V301), A264 (≠ G314), R307 (= R357), R334 (≠ T383), R334 (≠ T383)
Sites not aligning to the query:
- active site: 45, 48, 49
- binding flavin-adenine dinucleotide: 9, 10, 12, 14, 32, 33, 34, 40, 41, 42, 45, 46, 48
4yshA Crystal structure of glycine oxidase from geobacillus kaustophilus
24% identity, 76% coverage: 98:417/419 of query aligns to 51:368/370 of 4yshA
- active site: Q52 (≠ E99), I262 (≠ V312), L283 (≠ V333), G305 (= G355), N335 (≠ L384), L338 (≠ T387)
- binding flavin-adenine dinucleotide: V178 (≠ T223), S206 (≠ M254), G207 (= G255), W209 (≠ Y257), R307 (= R357), H332 (= H381), R334 (≠ T383), N335 (≠ L384), G336 (= G385), I337 (≠ W386)
Sites not aligning to the query:
- active site: 45, 48, 49
- binding flavin-adenine dinucleotide: 10, 12, 14, 32, 33, 34, 40, 41, 42, 45, 46, 47, 48
Q5L2C2 Glycine oxidase; GO; GOX; GOXK; EC 1.4.3.19 from Geobacillus kaustophilus (strain HTA426)
24% identity, 76% coverage: 98:417/419 of query aligns to 52:370/377 of Q5L2C2
- V180 (≠ T223) binding
- R309 (= R357) binding
- 334:340 (vs. 381:387, 29% identical) binding
- R336 (≠ T383) binding
Sites not aligning to the query:
- 14:15 binding
- 34:35 binding
- 42:43 binding
- 47:49 binding
7cyxA Crystal strcuture of glycine oxidase from bacillus cereus atcc 14579 (see paper)
22% identity, 99% coverage: 3:416/419 of query aligns to 4:360/363 of 7cyxA
- binding flavin-adenine dinucleotide: I7 (≠ M6), G8 (= G7), G10 (= G9), V11 (= V10), I12 (= I11), V30 (≠ I29), E31 (≠ D30), K32 (≠ R31), E38 (= E38), A39 (≠ T39), S40 (= S40), A43 (≠ N43), G45 (= G45), L46 (≠ Q46), V171 (≠ I224), G200 (≠ M254), G201 (= G255), W203 (≠ Y257), G298 (= G355), R300 (= R357), P301 (= P358), Y326 (≠ G382), R327 (≠ T383), N328 (≠ L384), G329 (= G385), I330 (≠ W386)
6j39A Crystal structure of cmis2 with inhibitor (see paper)
24% identity, 95% coverage: 11:408/419 of query aligns to 11:360/368 of 6j39A
- binding (3R)-3-[(carboxymethyl)sulfanyl]nonanoic acid: M44 (≠ Q46), P46 (≠ K63), N49 (≠ K66), R243 (vs. gap), Y252 (≠ V301), Y267 (≠ A316), R308 (= R357), R334 (≠ T383), I335 (≠ L384)
- binding flavin-adenine dinucleotide: I11 (= I11), V29 (≠ I29), D30 (= D30), P31 (≠ R31), E32 (≠ Q32), K36 (≠ E38), A37 (≠ T39), S38 (= S40), V40 (≠ A42), S41 (≠ N43), A42 (= A44), G43 (= G45), M44 (≠ Q46), A174 (= A228), A203 (≠ M254), W206 (≠ Y257), I228 (≠ S278), Y252 (≠ V301), R308 (= R357), S333 (≠ G382), R334 (≠ T383), I335 (≠ L384), G336 (= G385), V337 (≠ W386), Q338 (≠ T387)
Sites not aligning to the query:
6j38A Crystal structure of cmis2 (see paper)
24% identity, 95% coverage: 11:408/419 of query aligns to 11:360/368 of 6j38A
- binding flavin-adenine dinucleotide: I11 (= I11), V29 (≠ I29), D30 (= D30), P31 (≠ R31), K36 (≠ E38), A37 (≠ T39), S38 (= S40), S41 (≠ N43), A42 (= A44), G43 (= G45), M44 (≠ Q46), A174 (= A228), A203 (≠ M254), W206 (≠ Y257), G226 (= G276), G306 (= G355), R308 (= R357), S333 (≠ G382), R334 (≠ T383), I335 (≠ L384), G336 (= G385), V337 (≠ W386), Q338 (≠ T387)
Sites not aligning to the query:
1y56B Crystal structure of l-proline dehydrogenase from p.Horikoshii (see paper)
23% identity, 76% coverage: 103:419/419 of query aligns to 54:370/374 of 1y56B
- active site: H224 (≠ G276), P239 (= P290), G305 (= G355), M338 (≠ T387)
- binding flavin-adenine dinucleotide: E170 (≠ T223), V171 (≠ I224), T200 (≠ M254), N201 (≠ G255), W203 (≠ Y257), G305 (= G355), Y306 (≠ L356), Y307 (≠ R357), G334 (≠ T383), H335 (≠ L384), G336 (= G385), F337 (≠ W386), M338 (≠ T387)
- binding flavin mononucleotide: I260 (≠ V312), R301 (≠ E351), W303 (= W353)
Sites not aligning to the query:
- active site: 44, 47, 48
- binding flavin-adenine dinucleotide: 11, 13, 14, 15, 33, 34, 35, 42, 43, 45, 46, 47, 49
- binding flavin mononucleotide: 44, 45
2gagB Heteroteterameric sarcosine: structure of a diflavin metaloenzyme at 1.85 a resolution (see paper)
23% identity, 69% coverage: 128:417/419 of query aligns to 94:387/403 of 2gagB
- binding flavin-adenine dinucleotide: V195 (≠ I224), G224 (≠ M254), A225 (≠ G255), H227 (≠ Y257), L231 (≠ V261), L246 (≠ V274), G352 (= G382), T353 (= T383), G354 (≠ L384), G355 (= G385), F356 (≠ W386), K357 (≠ T387)
- binding flavin mononucleotide: H171 (≠ C200), V250 (≠ T284), E278 (≠ D308), R321 (≠ E351), W323 (= W353)
- binding 2-furoic acid: M263 (≠ D296), Y270 (≠ K300), K357 (≠ T387)
- binding sulfite ion: K170 (≠ D199), K276 (≠ L306)
Sites not aligning to the query:
- active site: 61, 64, 65
- binding flavin-adenine dinucleotide: 26, 28, 29, 30, 51, 52, 58, 59, 60, 62, 63, 64, 66
- binding flavin mononucleotide: 61, 62
- binding 2-furoic acid: 64, 66, 68, 401
Q50LF2 Sarcosine oxidase subunit beta; Sarcosine oxidase subunit B; Sarcosine oxidase (5,10-methylenetetrahydrofolate-forming) subunit beta; Tetrameric sarcosine oxidase subunit beta; TSOX subunit beta; EC 1.5.3.24 from Corynebacterium sp. (strain U-96) (see 4 papers)
24% identity, 48% coverage: 206:406/419 of query aligns to 179:378/405 of Q50LF2
- V197 (≠ I224) binding
- H270 (vs. gap) mutation to A: 10-fold decrease in catalytic efficiency.
- Y272 (≠ K300) mutation to A: 13000-fold decrease in catalytic efficiency.; mutation to F: 130-fold decrease in catalytic efficiency.
- G354 (= G382) binding
- G357 (= G385) binding
- K359 (≠ T387) binding ; mutation K->A,D: Loss of activity.; mutation to R: Retains 0.07% of wild-type activity. Shows higher apparent KM for sarcosine.
Sites not aligning to the query:
- 31 binding
- 32 binding
- 53 binding
- 61 binding
- 62 binding
- 66 binding
- 68 binding
- 172 K→A: Retains 39% of wild-type activity.; K→D: Retains 32% of wild-type activity.; K→R: Retains 58% of wild-type activity.
- 173 modified: Tele-8alpha-FMN histidine
1vrqB Crystal structure of heterotetrameric sarcosine oxidase from corynebacterium sp. U-96 in complex with folinic acid (see paper)
24% identity, 48% coverage: 206:406/419 of query aligns to 178:377/402 of 1vrqB
- active site: G326 (= G355), K358 (≠ T387)
- binding n,n-dimethylglycine: K358 (≠ T387)
- binding flavin-adenine dinucleotide: V196 (≠ I224), A224 (≠ C252), G225 (≠ A253), H228 (≠ S256), L247 (≠ V274), G353 (= G382), T354 (= T383), G355 (≠ L384), G356 (= G385), F357 (≠ W386), K358 (≠ T387)
- binding flavin mononucleotide: V251 (≠ T284), E279 (≠ D308), R322 (≠ E351), W324 (= W353)
Sites not aligning to the query:
- active site: 62, 65, 66
- binding n,n-dimethylglycine: 65, 67, 69, 401
- binding flavin-adenine dinucleotide: 26, 27, 29, 30, 31, 51, 52, 53, 59, 60, 61, 63, 64, 65, 67
- binding flavin mononucleotide: 62, 63, 172
3ad8B Heterotetrameric sarcosine oxidase from corynebacterium sp. U-96 in complex with pyrrole 2-carboxylate (see paper)
24% identity, 48% coverage: 206:406/419 of query aligns to 178:377/404 of 3ad8B
- active site: G326 (= G355), K358 (≠ T387)
- binding flavin-adenine dinucleotide: V196 (≠ I224), G225 (≠ A253), A226 (≠ M254), H228 (≠ S256), L247 (≠ V274), G353 (= G382), T354 (= T383), G355 (≠ L384), G356 (= G385), F357 (≠ W386), K358 (≠ T387)
- binding flavin mononucleotide: V251 (≠ T284), E279 (≠ D308), R322 (≠ E351), W324 (= W353)
- binding pyrrole-2-carboxylate: M264 (≠ D296), Y271 (≠ K300), T354 (= T383), K358 (≠ T387)
Sites not aligning to the query:
- active site: 62, 65, 66
- binding flavin-adenine dinucleotide: 26, 27, 29, 30, 31, 52, 53, 59, 60, 61, 63, 64, 65, 67
- binding flavin mononucleotide: 62, 63, 172
- binding pyrrole-2-carboxylate: 65, 67, 69, 402
3ad7B Heterotetrameric sarcosine oxidase from corynebacterium sp. U-96 in complex with methylthio acetate (see paper)
24% identity, 48% coverage: 206:406/419 of query aligns to 178:377/404 of 3ad7B
- active site: G326 (= G355), K358 (≠ T387)
- binding flavin-adenine dinucleotide: V196 (≠ I224), G225 (≠ A253), A226 (≠ M254), H228 (≠ S256), L247 (≠ V274), G353 (= G382), T354 (= T383), G355 (≠ L384), G356 (= G385), F357 (≠ W386), K358 (≠ T387)
- binding flavin mononucleotide: V251 (≠ T284), K277 (≠ L306), E279 (≠ D308), R322 (≠ E351), W324 (= W353)
- binding [methylthio]acetate: M264 (≠ D296), Y271 (≠ K300), T354 (= T383), K358 (≠ T387)
Sites not aligning to the query:
- active site: 62, 65, 66
- binding flavin-adenine dinucleotide: 26, 27, 29, 30, 31, 52, 53, 59, 60, 61, 63, 64, 65, 67
- binding flavin mononucleotide: 62, 63, 172
- binding [methylthio]acetate: 67, 69, 402
S5FMM4 Glycine oxidase; GO; BliGO; EC 1.4.3.19 from Bacillus licheniformis (see paper)
24% identity, 42% coverage: 239:416/419 of query aligns to 187:363/369 of S5FMM4
- S202 (≠ M254) mutation to C: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, R-81, V-332 and V-342.
- I332 (≠ W386) mutation to V: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, R-81, C-202 and V-342.
- M342 (≠ V396) mutation to V: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, R-81, C-202 and V-332.
Sites not aligning to the query:
- 51 G→S: Shows 4.3- and 107-fold increase of affinity to glyphosate and glycine, respectively. Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with R-54, R-81, C-202, V-332 and V-342.
- 54 A→R: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-81, C-202, V-332 and V-342.
- 81 K→R: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, C-202, V-332 and V-342.
P40875 Sarcosine oxidase subunit beta; Sarcosine oxidase subunit B; Sarcosine oxidase (5,10-methylenetetrahydrofolate-forming) subunit beta; Tetrameric sarcosine oxidase subunit beta; TSOX subunit beta; EC 1.5.3.24 from Corynebacterium sp. (strain P-1) (see 3 papers)
24% identity, 47% coverage: 206:400/419 of query aligns to 179:372/405 of P40875
- C195 (≠ Q222) mutation to S: No change in activity.
- C351 (≠ T379) mutation to A: No change in activity.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 30 G→A: Prevents covalent attachment of FMN. Blocks subunit assembly.
- 146 C→S: No change in activity.
- 173 modified: Tele-8alpha-FMN histidine; H→N: Prevents covalent attachment of FMN. Loss of activity. The mutant is considerably less stable than wild-type enzyme, the beta and delta subunits are lost during purification, which yields a stable alpha-gamma complex.
- 175 H→A: No effect on FMN binding and activity.
O31616 Glycine oxidase; GO; EC 1.4.3.19 from Bacillus subtilis (strain 168) (see 3 papers)
26% identity, 42% coverage: 242:419/419 of query aligns to 190:363/369 of O31616
- H244 (= H299) mutation to A: 2-fold decrease in catalytic efficiency on glycine and similar catalytic efficiency on glyphosate. 60-fold decrease in catalytic efficiency on glycine and 210-fold increase in that on glyphosate; when associated with S-51 and R-54.
- R302 (= R357) binding
- 327:333 (vs. 381:387, 29% identical) binding
- R329 (≠ T383) binding
Sites not aligning to the query:
- 14:15 binding
- 34:35 binding
- 42:43 binding
- 47:49 binding
- 51 G→R: 130-fold decrease in catalytic efficiency on glycine and 28-fold increase in that on glyphosate.; G→S: 60-fold decrease in catalytic efficiency on glycine and 210-fold increase in that on glyphosate; when associated with R-54 and A-244.
- 54 A→R: 20-fold decrease in catalytic efficiency on glycine and 34-fold increase in that on glyphosate. 60-fold decrease in catalytic efficiency on glycine and 210-fold increase in that on glyphosate; when associated with S-51 and A-244.
- 174 binding
1ng3A Complex of thio (glycine oxidase) with acetyl-glycine (see paper)
26% identity, 42% coverage: 242:419/419 of query aligns to 190:363/364 of 1ng3A
- binding acetylamino-acetic acid: Y246 (≠ V301), R302 (= R357), R329 (≠ T383)
- binding flavin-adenine dinucleotide: S202 (≠ M254), G203 (= G255), W205 (≠ Y257), F209 (≠ V261), G300 (= G355), R302 (= R357), H327 (= H381), R329 (≠ T383), N330 (≠ L384), G331 (= G385), I332 (≠ W386)
- binding phosphate ion: R254 (= R309)
Sites not aligning to the query:
- active site: 47, 48, 49
- binding flavin-adenine dinucleotide: 11, 13, 15, 33, 34, 35, 41, 42, 43, 46, 47, 48, 49, 174
- binding phosphate ion: 89
Q9AGP8 Dimethylglycine oxidase; DMGO; EC 1.5.3.10 from Arthrobacter globiformis (see 2 papers)
23% identity, 58% coverage: 134:376/419 of query aligns to 86:354/830 of Q9AGP8
- V174 (≠ I224) binding
- H225 (≠ K275) Important for catalytic activity; mutation to Q: Reduces catalytic efficiency 3-fold and substrate affinity 30-fold.
- Y259 (≠ A302) Important for catalytic activity; binding ; mutation to F: Reduces catalytic efficiency 225-fold and substrate affinity 25-fold.
Sites not aligning to the query:
- 14:15 binding
- 35:36 binding
- 45:48 binding
- 52 binding
- 360:363 binding
- 539 binding
- 552 Important for catalytic activity; D→A: No effect on the activity.; D→N: Reduces activity 3-fold.
1pj7A Structure of dimethylglycine oxidase of arthrobacter globiformis in complex with folinic acid (see paper)
23% identity, 58% coverage: 134:376/419 of query aligns to 83:351/827 of 1pj7A
Sites not aligning to the query:
- active site: 549
- binding flavin-adenine dinucleotide: 8, 10, 11, 12, 32, 33, 41, 42, 43, 45, 47, 49, 357, 358, 359, 360
- binding N-[4-({[(6S)-2-amino-5-formyl-4-oxo-3,4,5,6,7,8-hexahydropteridin-6-yl]methyl}amino)benzoyl]-L-glutamic acid: 505, 536, 549, 551, 563, 629, 648, 655, 696
1pj6A Crystal structure of dimethylglycine oxidase of arthrobacter globiformis in complex with folic acid (see paper)
23% identity, 58% coverage: 134:376/419 of query aligns to 84:352/828 of 1pj6A
Sites not aligning to the query:
- active site: 550
- binding flavin-adenine dinucleotide: 9, 11, 12, 13, 33, 34, 42, 43, 44, 46, 48, 50, 358, 359, 360, 361
3gsiA Crystal structure of d552a dimethylglycine oxidase mutant of arthrobacter globiformis in complex with tetrahydrofolate (see paper)
23% identity, 58% coverage: 134:376/419 of query aligns to 83:351/827 of 3gsiA
- active site: H222 (≠ K275), Y256 (≠ A302)
- binding flavin-adenine dinucleotide: T170 (= T223), V171 (≠ I224), A200 (≠ M254), G201 (= G255), W203 (≠ Y257), H222 (≠ K275), Y256 (≠ A302), G330 (= G355), I331 (≠ L356), F332 (≠ R357)
- binding magnesium ion: D254 (≠ K300)
Sites not aligning to the query:
- active site: 549
- binding flavin-adenine dinucleotide: 10, 11, 12, 32, 33, 41, 42, 43, 45, 47, 49, 357, 358, 359, 360
- binding magnesium ion: 409
- binding (6s)-5,6,7,8-tetrahydrofolate: 505, 536, 551, 563, 629, 648, 655, 696
Query Sequence
>3607136 FitnessBrowser__Dino:3607136
MKVVIMGAGVIGVTTAYYLAKQGVKVVVIDRQTGPGLETSYANAGQLSYGMSSPWAAPGI
PLKAVKWMFMKRRPLFIMPLLSPTMWKWCLQMLRNCNAESYAINKGRMVRVSSYSRDVMP
DLIADTGIEYDGRQMGTLQLFRTAKQMKASKADQAVLAEYGSPYEVLGRDACIEVEPALA
EVRGKFVGGLRLTSDRTGDCRMFTIALTDKCIEMGVEFQYGQTIKAIAVENGKISGVDTE
IAGRISGDAYVCAMGSYAVNVLNPIGIRLPVYPVKGYSVTLPVTNDAFAPQSTIMDETHK
VAITRLGDRIRVAGQAEIVGYSNRLGPHATDTVRHVIGDLFPKGGDLSRAEGWTGLRPMT
PDGTPVLGPTRYENLFLNTGHGTLGWTMACGSGRAVADVVMGKPPEISMEGLTAARYAR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory