Comparing 3607183 FitnessBrowser__Dino:3607183 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 3 hits to proteins with known functional sites (download)
O87170 2-pyrone-4,6-dicarboxylate hydrolase; PDC hydrolase; 2-pyrone-4,6-dicarboxylate lactonase; EC 3.1.1.57 from Sphingobium sp. (strain NBRC 103272 / SYK-6) (see paper)
37% identity, 99% coverage: 3:284/286 of query aligns to 5:288/293 of O87170
4di8A Crystal structure of the d248a mutant of 2-pyrone-4,6-dicarboxylic acid hydrolase from sphingomonas paucimobilis complexed with substrate at ph 8.5 (see paper)
36% identity, 99% coverage: 3:284/286 of query aligns to 6:289/294 of 4di8A
A9CEQ7 D-galactarolactone isomerase; GLI; Galactaro delta-lactone isomerase; EC 5.4.1.4 from Agrobacterium fabrum (strain C58 / ATCC 33970) (Agrobacterium tumefaciens (strain C58)) (see paper)
30% identity, 95% coverage: 13:284/286 of query aligns to 11:284/292 of A9CEQ7
>3607183 FitnessBrowser__Dino:3607183
MTQACLAHLQDPSPPKRPLPPGATDCHSHVIVPEADHPFVANRSYTPPPATLAQYKALHA
RLGIERAVIVQPSVYGTDNSVTLEAIAGYGPGCRGIAVVDADVSMRDLQAMNAAGIRGAR
INMLFSGGIGLDDLEPLARRIADLDWHFQLLIDGPTLADLEARLANLPVPVVIDHMGHMQ
THDGLDQPGFRALRRLVVRGNTWVKLSGNYRMSSQRPRFEDVVPFAQALISDNSEHMVWG
TDWPHPAMLDFMPDDGSLVDALDAYVTSQDQKQRILVDNPATLYGF
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory