SitesBLAST
Comparing 3607199 FitnessBrowser__Dino:3607199 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4nbuB Crystal structure of fabg from bacillus sp (see paper)
35% identity, 95% coverage: 1:238/250 of query aligns to 5:242/244 of 4nbuB
- active site: G18 (= G14), N111 (= N107), S139 (= S134), Q149 (≠ R144), Y152 (= Y147), K156 (= K151)
- binding acetoacetyl-coenzyme a: D93 (≠ F89), K98 (≠ E94), S139 (= S134), N146 (≠ S141), V147 (≠ T142), Q149 (≠ R144), Y152 (= Y147), F184 (≠ P179), M189 (≠ L184), K200 (≠ A196)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G10), N17 (≠ R13), G18 (= G14), I19 (= I15), D38 (= D34), F39 (≠ R35), V59 (≠ C55), D60 (= D56), V61 (= V57), N87 (= N83), A88 (= A84), G89 (= G85), I90 (≠ V86), T137 (≠ I132), S139 (= S134), Y152 (= Y147), K156 (= K151), P182 (= P177), F184 (≠ P179), T185 (≠ V180), T187 (= T182), M189 (≠ L184)
3osuA Crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus
37% identity, 94% coverage: 3:238/250 of query aligns to 4:244/246 of 3osuA
5itvA Crystal structure of bacillus subtilis bacc dihydroanticapsin 7- dehydrogenase in complex with nadh (see paper)
37% identity, 96% coverage: 1:240/250 of query aligns to 5:254/255 of 5itvA
- active site: G18 (= G14), S141 (= S134), Y154 (= Y147), K158 (= K151)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G10), S17 (≠ R13), G18 (= G14), I19 (= I15), D38 (= D34), I39 (≠ R35), T61 (≠ C55), I63 (≠ V57), N89 (= N83), G91 (= G85), T139 (≠ I132), S141 (= S134), Y154 (= Y147), K158 (= K151), P184 (= P177), G185 (= G178), I186 (vs. gap), I187 (vs. gap)
3sj7A Structure of beta-ketoacetyl-coa reductase (fabg) from staphylococcus aureus complex with NADPH (see paper)
36% identity, 94% coverage: 3:238/250 of query aligns to 1:237/239 of 3sj7A
- active site: G12 (= G14), S138 (= S134), Q148 (≠ R144), Y151 (= Y147), K155 (= K151)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G10), S10 (≠ A12), R11 (= R13), I13 (= I15), N31 (≠ I33), Y32 (≠ D34), A33 (≠ R35), G34 (≠ D36), S35 (≠ G37), A58 (≠ C55), N59 (≠ D56), V60 (= V57), N86 (= N83), A87 (= A84), T109 (= T106), S138 (= S134), Y151 (= Y147), K155 (= K151), P181 (= P177), G182 (= G178)
5itvD Crystal structure of bacillus subtilis bacc dihydroanticapsin 7- dehydrogenase in complex with nadh (see paper)
36% identity, 96% coverage: 1:240/250 of query aligns to 5:226/227 of 5itvD
- active site: G18 (= G14), S141 (= S134), Y154 (= Y147), K158 (= K151)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G10), S17 (≠ R13), G18 (= G14), I19 (= I15), D38 (= D34), I39 (≠ R35), T61 (≠ C55), D62 (= D56), I63 (≠ V57), N89 (= N83), T139 (≠ I132), S141 (= S134), Y154 (= Y147), K158 (= K151), P184 (= P177), G185 (= G178), I187 (= I194)
6vspB Structure of serratia marcescens 2,3-butanediol dehydrogenase mutant q247a (see paper)
37% identity, 96% coverage: 3:241/250 of query aligns to 7:246/252 of 6vspB
6vspA Structure of serratia marcescens 2,3-butanediol dehydrogenase mutant q247a (see paper)
37% identity, 96% coverage: 3:241/250 of query aligns to 5:244/251 of 6vspA
- active site: G16 (= G14), S138 (= S134), Y151 (= Y147)
- binding nicotinamide-adenine-dinucleotide: G12 (= G10), N15 (≠ R13), G16 (= G14), M17 (≠ I15), D36 (= D34), W37 (≠ R35), W37 (≠ R35), A38 (≠ D36), I59 (≠ C55), D60 (= D56), V61 (= V57), N87 (= N83), A88 (= A84), G89 (= G85), V90 (= V86), V110 (≠ T106), T136 (≠ I132), S138 (= S134), Y151 (= Y147), K155 (= K151), P181 (= P177), S182 (≠ G178), L183 (≠ P179), V184 (= V180), T186 (= T182), N187 (≠ K183), M188 (≠ L184), T189 (≠ A185)
6xewA Structure of serratia marcescens 2,3-butanediol dehydrogenase (see paper)
37% identity, 96% coverage: 3:241/250 of query aligns to 5:244/251 of 6xewA
- active site: G16 (= G14), S138 (= S134), Y151 (= Y147)
- binding r,3-hydroxybutan-2-one: S138 (= S134), S140 (= S136), Y151 (= Y147)
- binding s,3-hydroxybutan-2-one: S138 (= S134), Y151 (= Y147), S182 (≠ G178)
- binding nicotinamide-adenine-dinucleotide: G12 (= G10), N15 (≠ R13), G16 (= G14), M17 (≠ I15), D36 (= D34), W37 (≠ R35), W37 (≠ R35), A38 (≠ D36), I59 (≠ C55), D60 (= D56), V61 (= V57), N87 (= N83), A88 (= A84), G89 (= G85), V110 (≠ T106), T136 (≠ I132), S138 (= S134), Y151 (= Y147), K155 (= K151), S182 (≠ G178), L183 (≠ P179), V184 (= V180), T186 (= T182), N187 (≠ K183), M188 (≠ L184), T189 (≠ A185)
H9XP47 Meso-2,3-butanediol dehydrogenase; BDH; meso-2,3-BDH; (R,S)-butane-2,3-diol dehydrogenase; NAD(H)-dependent meso-2,3-BDH; SmBdh; EC 1.1.1.- from Serratia marcescens (see paper)
37% identity, 96% coverage: 3:241/250 of query aligns to 5:244/251 of H9XP47
- N15 (≠ R13) binding
- M17 (≠ I15) binding
- D36 (= D34) binding
- D60 (= D56) binding
- V61 (= V57) binding
- N87 (= N83) binding
- S138 (= S134) binding ; binding
- V139 (≠ I135) mutation to Q: Retains 50% of activity with acetoin as substrate; when associated with A-247.
- S140 (= S136) binding
- Y151 (= Y147) binding ; binding ; binding
- K155 (= K151) binding
- V184 (= V180) binding
- T186 (= T182) binding
- RDK 197:199 (≠ IDA 194:196) mutation to SEAAGKPLGYGTET: Mimics longer alpha6 helix. Retains 3% of activity with acetoin as substrate.
Sites not aligning to the query:
- 247 Q→A: Retains 10% of activity with acetoin as substrate. Retains 50% of activity with acetoin as substrate; when associated with Q-139.
2cfcA Structural basis for stereo selectivity in the (r)- and (s)- hydroxypropylethane thiosulfonate dehydrogenases (see paper)
38% identity, 95% coverage: 3:240/250 of query aligns to 2:249/250 of 2cfcA
- active site: G13 (= G14), S142 (= S134), Y155 (= Y147), K159 (= K151)
- binding (2-[2-ketopropylthio]ethanesulfonate: F149 (≠ S141), R152 (= R144), Y155 (= Y147), W195 (≠ A187), R196 (≠ V188)
- binding nicotinamide-adenine-dinucleotide: G9 (= G10), S12 (≠ R13), G13 (= G14), N14 (≠ I15), D33 (= D34), L34 (≠ R35), A59 (≠ C55), D60 (= D56), V61 (= V57), N87 (= N83), A88 (= A84), G89 (= G85), I140 (= I132), P185 (= P177), G186 (= G178), M187 (≠ P179), I188 (≠ V180), T190 (= T182), P191 (≠ K183), M192 (≠ L184), T193 (≠ A185)
Q56840 2-(R)-hydroxypropyl-CoM dehydrogenase; R-HPCDH; 2-[(R)-2-hydroxypropylthio]ethanesulfonate dehydrogenase; Aliphatic epoxide carboxylation component III; Epoxide carboxylase component III; RHPCDH1; EC 1.1.1.268 from Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) (see 4 papers)
38% identity, 95% coverage: 3:240/250 of query aligns to 2:249/250 of Q56840
- SGN 12:14 (≠ RGI 13:15) binding
- D33 (= D34) binding
- DV 60:61 (= DV 56:57) binding
- N87 (= N83) binding
- S142 (= S134) mutation to A: Retains weak activity. 120-fold decrease in kcat.; mutation to C: Loss of activity.
- R152 (= R144) binding ; mutation to A: Almost loss of activity with the natural substrate 2-KPC, but does not affect activity with 2-butanone as substrate.
- Y155 (= Y147) mutation Y->E,F: Loss of activity.
- K159 (= K151) mutation to A: Loss of activity.
- R179 (= R171) mutation to A: Loss of activity.
- IETPM 188:192 (≠ VRTKL 180:184) binding
- WR 195:196 (≠ AV 187:188) binding
- R196 (≠ V188) mutation to A: Almost loss of activity with the natural substrate 2-KPC, but does not affect activity with 2-butanone as substrate.
- R203 (≠ I194) mutation to A: Slight decrease in catalytic efficiency.
- R209 (≠ A200) mutation to A: Does not affect catalytic efficiency.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
5ha5D Crystal structure of an NAD-bound oxidoreductase from brucella ovis
38% identity, 96% coverage: 1:240/250 of query aligns to 4:243/244 of 5ha5D
- active site: G17 (= G14), S142 (= S134), Y155 (= Y147), K159 (= K151)
- binding nicotinamide-adenine-dinucleotide: G13 (= G10), R16 (= R13), G17 (= G14), L18 (≠ I15), D37 (= D34), I38 (≠ R35), L62 (≠ C55), D63 (= D56), V64 (= V57), N90 (= N83), A91 (= A84), S142 (= S134), Y155 (= Y147), K159 (= K151), G186 (= G178), M188 (≠ V180), S190 (≠ T182)
4wecA Crystal structure of a short chain dehydrogenase from mycobacterium smegmatis
36% identity, 96% coverage: 1:240/250 of query aligns to 8:252/258 of 4wecA
- active site: G21 (= G14), S143 (= S134), Q154 (≠ R144), Y157 (= Y147), K161 (= K151)
- binding nicotinamide-adenine-dinucleotide: G17 (= G10), A19 (= A12), S20 (≠ R13), G21 (= G14), I22 (= I15), D41 (= D34), I42 (≠ R35), V61 (≠ C55), D62 (= D56), V63 (= V57), N89 (= N83), T141 (≠ I132), Y157 (= Y147), K161 (= K151), P187 (= P177), P189 (= P179), V190 (= V180)
1vl8B Crystal structure of gluconate 5-dehydrogenase (tm0441) from thermotoga maritima at 2.07 a resolution
34% identity, 96% coverage: 1:241/250 of query aligns to 4:252/252 of 1vl8B
- active site: G17 (= G14), S143 (= S134), I154 (≠ V145), Y157 (= Y147), K161 (= K151)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G10), R16 (= R13), G17 (= G14), L18 (≠ I15), S37 (≠ D34), R38 (= R35), C63 (= C55), D64 (= D56), V65 (= V57), A91 (≠ N83), A92 (= A84), G93 (= G85), I94 (≠ V86), V114 (≠ T106), I141 (= I132), S143 (= S134), Y157 (= Y147), K161 (= K151), P187 (= P177), G188 (= G178), Y190 (≠ V180), T192 (= T182), M194 (≠ L184), T195 (≠ A185)
6ixmC Crystal structure of the ketone reductase chkred20 from the genome of chryseobacterium sp. Ca49 complexed with NAD (see paper)
35% identity, 96% coverage: 1:240/250 of query aligns to 3:247/248 of 6ixmC
- active site: G16 (= G14), S142 (= S134), Y155 (= Y147), K159 (= K151)
- binding nicotinamide-adenine-dinucleotide: G12 (= G10), S15 (≠ R13), G16 (= G14), I17 (= I15), D36 (= D34), I37 (≠ R35), A61 (≠ C55), D62 (= D56), T63 (≠ V57), N89 (= N83), A90 (= A84), M140 (≠ I132), S142 (= S134), Y155 (= Y147), K159 (= K151), P185 (= P177), A186 (≠ G178), Y187 (≠ P179), I188 (≠ V180), L192 (= L184)
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
35% identity, 95% coverage: 1:238/250 of query aligns to 3:245/247 of 4jroC
- active site: G16 (= G14), S142 (= S134), Q152 (≠ R144), Y155 (= Y147), K159 (= K151)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G10), S14 (≠ A12), R15 (= R13), G16 (= G14), I17 (= I15), N35 (≠ I33), Y36 (≠ D34), N37 (≠ R35), G38 (≠ D36), S39 (≠ G37), N63 (≠ D56), V64 (= V57), N90 (= N83), A91 (= A84), I93 (≠ V86), I113 (≠ T106), S142 (= S134), Y155 (= Y147), K159 (= K151), P185 (= P177), I188 (≠ V180), T190 (= T182)
2dtxA Structure of thermoplasma acidophilum aldohexose dehydrogenase (aldt) in complex with d-mannose (see paper)
34% identity, 95% coverage: 1:238/250 of query aligns to 5:245/255 of 2dtxA
2dteA Structure of thermoplasma acidophilum aldohexose dehydrogenase (aldt) in complex with nadh (see paper)
34% identity, 95% coverage: 1:238/250 of query aligns to 5:245/255 of 2dteA
- active site: G18 (= G14), S132 (= S134), Y145 (= Y147), S148 (= S150), K149 (= K151)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G14 (= G10), S16 (≠ A12), M17 (≠ R13), G18 (= G14), I19 (= I15), S38 (≠ D34), I39 (≠ R35), C52 (= C55), D53 (= D56), V54 (= V57), N80 (= N83), A81 (= A84), I130 (= I132), S132 (= S134), Y145 (= Y147), K149 (= K151), P174 (= P177), A175 (≠ G178), T176 (≠ P179), I177 (≠ V180), T179 (= T182), P180 (≠ K183), L181 (= L184), V182 (≠ A185)
7tzpG Crystal structure of putataive short-chain dehydrogenase/reductase (fabg) from klebsiella pneumoniae subsp. Pneumoniae ntuh-k2044 in complex with nadh (see paper)
35% identity, 95% coverage: 1:238/250 of query aligns to 6:245/247 of 7tzpG
- binding 1,4-dihydronicotinamide adenine dinucleotide: G15 (= G10), R18 (= R13), G19 (= G14), I20 (= I15), D39 (= D34), R40 (= R35), C63 (= C55), I65 (≠ V57), N91 (= N83), G93 (= G85), I94 (≠ V86), V114 (≠ T106), Y155 (= Y147), K159 (= K151), I188 (≠ V180), T190 (= T182), T193 (≠ A185)
6zzsD Crystal structure of (r)-3-hydroxybutyrate dehydrogenase from acinetobacter baumannii complexed with NAD+ and 3-oxovalerate (see paper)
35% identity, 96% coverage: 1:240/250 of query aligns to 5:260/261 of 6zzsD
- active site: G18 (= G14), S143 (= S134), Y156 (= Y147)
- binding nicotinamide-adenine-dinucleotide: G14 (= G10), S17 (≠ R13), I19 (= I15), D38 (= D34), M39 (≠ R35), D64 (= D56), V65 (= V57), N91 (= N83), A92 (= A84), G93 (= G85), M141 (≠ I132), A142 (= A133), S143 (= S134), Y156 (= Y147), K160 (= K151), P186 (= P177), G187 (= G178), V189 (= V180), T191 (= T182), L193 (= L184)
- binding 3-oxidanylidenepentanoic acid: Q95 (≠ A87), S143 (= S134), N145 (≠ S136), K153 (≠ R144), Y156 (= Y147), Q197 (vs. gap)
Query Sequence
>3607199 FitnessBrowser__Dino:3607199
MTSKTAVVTGAARGIGLATTKLLLERGWKVAMIDRDGPALAEALQGLDGVHGIDCDVSDP
EAVEGMIAETLREFGQIDALVNNAGVADFGPIEETSFARWKTVMETNLDGPFLCVQAATP
ALKATKGAVVNIASISGLRASTLRVAYGTSKAAVIQLTLQQAVELGEHGIRANCVCPGPV
RTKLAMAVHSQEIIDAYHDAIPLNRYGSEQEIAEAILFLCSERASFITGQVLAADGGFEA
TGIGLPALRG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory