Comparing 3607217 FitnessBrowser__Dino:3607217 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 11 hits to proteins with known functional sites (download)
3u9eB The crystal structure of a possible phosphate acetyl/butaryl transferase (from listeria monocytogenes egd-e) in complex with coa.
43% identity, 47% coverage: 246:467/471 of query aligns to 69:286/288 of 3u9eB
3uf6A The crystal structure of a possible phosphate acetyl/butaryl transferase (from listeria monocytogenes egd-e) in complex with cod (3'-dephosphocoenzyme a)
43% identity, 47% coverage: 246:467/471 of query aligns to 67:284/285 of 3uf6A
Q8ZND6 Phosphate acetyltransferase; Phosphotransacetylase; EC 2.3.1.222; EC 2.3.1.8 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
27% identity, 54% coverage: 191:444/471 of query aligns to 406:686/714 of Q8ZND6
Sites not aligning to the query:
O32472 (R)-specific enoyl-CoA hydratase; EC 4.2.1.119 from Aeromonas caviae (Aeromonas punctata) (see 2 papers)
35% identity, 28% coverage: 23:152/471 of query aligns to 4:134/134 of O32472
Sites not aligning to the query:
P86397 Hydroxyacyl-thioester dehydratase type 2, mitochondrial; HsHTD2; 3-hydroxyacyl-[acyl-carrier-protein] dehydratase; EC 4.2.1.59 from Homo sapiens (Human) (see paper)
27% identity, 28% coverage: 24:153/471 of query aligns to 35:164/168 of P86397
Sites not aligning to the query:
A0A3Q7HWE4 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FERN, mitochondrial; 3-hydroxyl-ACP dehydratase FERN; Protein FERN-LIKE; SlFERN; EC 4.2.1.59 from Solanum lycopersicum (Tomato) (Lycopersicon esculentum) (see paper)
27% identity, 27% coverage: 25:153/471 of query aligns to 23:152/165 of A0A3Q7HWE4
1xcoD Crystal structure of a phosphotransacetylase from bacillus subtilis in complex with acetylphosphate (see paper)
28% identity, 52% coverage: 207:452/471 of query aligns to 39:309/325 of 1xcoD
6ioxA Crystal structure of porphyromonas gingivalis phosphotransacetylase in complex with acetyl-coa (see paper)
25% identity, 60% coverage: 191:471/471 of query aligns to 22:331/339 of 6ioxA
P38503 Phosphate acetyltransferase; Phosphotransacetylase; EC 2.3.1.8 from Methanosarcina thermophila (see 2 papers)
27% identity, 58% coverage: 199:469/471 of query aligns to 55:330/333 of P38503
Sites not aligning to the query:
2af3C Phosphotransacetylase from methanosarcina thermophila soaked with coenzyme a (see paper)
27% identity, 58% coverage: 199:469/471 of query aligns to 54:329/332 of 2af3C
P76558 NADP-dependent malic enzyme; NADP-ME; EC 1.1.1.40 from Escherichia coli (strain K12) (see paper)
24% identity, 55% coverage: 188:444/471 of query aligns to 442:731/759 of P76558
Sites not aligning to the query:
>3607217 FitnessBrowser__Dino:3607217
MCPRTLPAEPRLAEGRPMSSVFDDLEIGATAETSRLCREEDLIVFANASGNFNPLTVPDQ
DGDGDGVPEAVAPAMWVASLISSVLGNKLPGPGMRYRAQSLFFRAPVLAGETVVARVKLL
EKKADRVVRLETIVETQGGRRLLDGEAEVIAPETRIMLDAANVPGLLVQRHVHFERMILR
AEPLPPFPTAVVAPEEPDALAGTILGAEHTLITPLLIGDPDRIAAAAAEKGIDLAPYEII
AEPHHKAAAACAVRLVHEGRAKAIMKGHLHTDVLLSAILKKDGGLRGTRRLSHVFVMDVP
GLDHPLFISDAAINIAPDLKTKADITQNAIDLALAIGVTMPKVGILSAVETVNPAIPSTL
DAAILSKMAERGQITGGLVDGPLAMDNAVDLAAARTKGIISKVAGQADILIVPNMEAGNM
LAKQLTYLAHADAGGIVMGAQCPVILNSRADNDKARLASCAIAALLVGATA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory