Comparing 3607221 FitnessBrowser__Dino:3607221 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
3oajA Crystal structure of putative dioxygenase from bacillus subtilis subsp. Subtilis str. 168
45% identity, 97% coverage: 8:305/307 of query aligns to 6:307/310 of 3oajA
Q9WXE6 Chlorohydroquinone/hydroquinone 1,2-dioxygenase; (Chloro)hydroquinone 1,2-dioxygenase; (C)HQ 1,2-dioxygenase; EC 1.13.11.66 from Sphingobium indicum (strain DSM 16413 / CCM 7287 / MTCC 6362 / UT26 / NBRC 101211 / UT26S) (Sphingobium japonicum) (see paper)
36% identity, 96% coverage: 6:300/307 of query aligns to 8:315/321 of Q9WXE6
1zswA Crystal structure of bacillus cereus metallo protein from glyoxalase family
36% identity, 97% coverage: 6:303/307 of query aligns to 18:325/328 of 1zswA
4huzA 2,6-dichloro-p-hydroquinone 1,2-dioxygenase (see paper)
33% identity, 97% coverage: 4:300/307 of query aligns to 2:311/317 of 4huzA
>3607221 FitnessBrowser__Dino:3607221
MKHNTIPGLHHVTAISGPPQDNLDFFTGTLGQRLVKKTVNFDAPDTYHLYYGNETAEPGT
ILTFFPFVDAGPGRAGPGMASAYAYAVPAGRFDGWMARLAEDAIDFNGPVERFGQRVITL
RDPDGAPVELIETDRVAQAPLDGFHSVTLWEADPEPTAKLLTEVFGYTDGGTETGEGIER
LRLVAPGDARGAVVDLIRTDTPSIGRSGAGTIHHVAFRAQDHDTHMGWREKLLGLGHGLT
PVIDRQYFDAIYFREPGGVLFEIATDPPGFATDEPMEALGRKLMLPPQHEPLRDRIERVL
PPLRTAA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory