SitesBLAST
Comparing 3607265 Dshi_0680 phosphoribosylaminoimidazole carboxylase, ATPase subunit (RefSeq) to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4dlkA Crystal structure of atp-ca++ complex of purk: n5- carboxyaminoimidazole ribonucleotide synthetase (see paper)
42% identity, 98% coverage: 1:351/357 of query aligns to 1:353/380 of 4dlkA
- active site: Y153 (= Y153), G155 (= G155), E255 (= E255), E268 (= E267), N275 (= N274), S276 (= S275), K348 (= K346)
- binding adenosine-5'-triphosphate: E76 (= E76), F77 (= F77), R107 (= R107), K147 (= K147), Y153 (= Y153), D154 (= D154), G155 (= G155), Q158 (= Q158), W184 (≠ F184), V185 (= V185), F187 (= F187), E190 (= E190), E255 (= E255), F257 (= F257), N267 (= N266), E268 (= E267), R272 (= R271), H274 (= H273), N275 (= N274), K340 (= K338), R347 (= R345), K348 (= K346)
- binding calcium ion: E255 (= E255), E268 (= E267)
- binding phosphate ion: Q47 (= Q47), A49 (= A49)
3r5hA Crystal structure of adp-air complex of purk: n5-carboxyaminoimidazole ribonucleotide synthetase (see paper)
42% identity, 98% coverage: 1:351/357 of query aligns to 1:353/383 of 3r5hA
- binding adenosine-5'-diphosphate: R107 (= R107), K147 (= K147), Q158 (= Q158), W184 (≠ F184), V185 (= V185), F187 (= F187), E190 (= E190), N216 (≠ G216), F257 (= F257), N267 (= N266), E268 (= E267)
- binding 5-aminoimidazole ribonucleotide: G17 (= G17), Q18 (= Q18), L19 (= L19), E76 (= E76), Y153 (= Y153), R272 (= R271), K340 (= K338), R347 (= R345)
3v4sB Crystal structure of adp-atp complex of purk: n5-carboxyaminoimidazole ribonucleotide synthetase (see paper)
42% identity, 98% coverage: 1:351/357 of query aligns to 2:354/381 of 3v4sB
- binding adenosine-5'-triphosphate: R108 (= R107), K148 (= K147), Y154 (= Y153), D155 (= D154), G156 (= G155), Q159 (= Q158), E183 (= E182), W185 (≠ F184), V186 (= V185), F188 (= F187), E191 (= E190), H214 (= H213), N217 (≠ G216), E256 (= E255), F258 (= F257), E269 (= E267)
- binding carbonate ion: R273 (= R271), H275 (= H273), N276 (= N274)
- binding magnesium ion: T105 (≠ S104), E111 (= E110), E256 (= E255), E269 (= E267), L270 (≠ I268)
3q2oB Crystal structure of purk: n5-carboxyaminoimidazole ribonucleotide synthetase (see paper)
42% identity, 98% coverage: 1:351/357 of query aligns to 1:353/377 of 3q2oB
3v4sA Crystal structure of adp-atp complex of purk: n5-carboxyaminoimidazole ribonucleotide synthetase (see paper)
42% identity, 98% coverage: 2:351/357 of query aligns to 1:352/380 of 3v4sA
- binding adenosine-5'-diphosphate: R106 (= R107), K146 (= K147), Y152 (= Y153), G154 (= G155), Q157 (= Q158), W183 (≠ F184), V184 (= V185), E189 (= E190), N215 (≠ G216), F256 (= F257), N266 (= N266), E267 (= E267)
- binding carbonate ion: R271 (= R271), H273 (= H273), N274 (= N274)
3aw8A Crystal structure of n5-carboxyaminoimidazole ribonucleotide synthetase from thermus thermophilus hb8
46% identity, 92% coverage: 21:349/357 of query aligns to 12:332/360 of 3aw8A
- active site: E240 (= E255), E252 (= E267), N259 (= N274), S260 (= S275), K329 (= K346)
- binding adenosine monophosphate: L135 (≠ I145), K137 (= K147), Q142 (= Q158), F168 (= F184), V169 (= V185), E174 (= E190), H197 (= H213), F242 (= F257), E252 (= E267)
3orqA Crystal structure of n5-carboxyaminoimidazole synthetase from staphylococcus aureus complexed with adp (see paper)
38% identity, 97% coverage: 5:349/357 of query aligns to 8:353/373 of 3orqA
- active site: Y156 (= Y153), E256 (= E255), E269 (= E267), N276 (= N274), S277 (= S275), K350 (= K346)
- binding adenosine-5'-diphosphate: R110 (= R107), K150 (= K147), Y156 (= Y153), D157 (= D154), Q161 (= Q158), E185 (= E182), Y187 (≠ F184), L188 (≠ V185), I190 (≠ F187), E193 (= E190), H216 (= H213), F258 (= F257), E269 (= E267)
- binding magnesium ion: E256 (= E255), E269 (= E267)
- binding pyrophosphate 2-: Y156 (= Y153), K342 (= K338), R349 (= R345)
5jqwA The crystal structure of phosphoribosylaminoimidazole carboxylase atpase subunit of francisella tularensis subsp. Tularensis schu s4 in complex with adp
41% identity, 96% coverage: 11:351/357 of query aligns to 3:340/365 of 5jqwA
- active site: Y144 (= Y153), G146 (= G155), E247 (= E255), E259 (= E267), N266 (= N274), S267 (= S275), K335 (= K346)
- binding adenosine-5'-diphosphate: R98 (= R107), K138 (= K147), G143 (= G152), Y144 (= Y153), D145 (= D154), G146 (= G155), V178 (= V185), E183 (= E190), H206 (= H213), F249 (= F257), E259 (= E267)
4ma0A The crystal structure of phosphoribosylaminoimidazole carboxylase atpase subunit of francisella tularensis subsp. Tularensis schu s4 in complex with partially hydrolysed atp
41% identity, 96% coverage: 11:351/357 of query aligns to 3:340/366 of 4ma0A
- active site: Y144 (= Y153), G146 (= G155), E247 (= E255), E259 (= E267), N266 (= N274), S267 (= S275), K335 (= K346)
- binding adenosine monophosphate: I136 (= I145), K138 (= K147), E175 (= E182), A176 (≠ G183), F177 (= F184), V178 (= V185), E183 (= E190), H206 (= H213), F249 (= F257), E259 (= E267)
4mamA The crystal structure of phosphoribosylaminoimidazole carboxylase atpase subunit of francisella tularensis subsp. Tularensis schu s4 in complex with an adp analog, amp-cp
41% identity, 96% coverage: 11:351/357 of query aligns to 3:340/373 of 4mamA
- active site: Y144 (= Y153), G146 (= G155), E247 (= E255), E259 (= E267), N266 (= N274), S267 (= S275), K335 (= K346)
- binding phosphomethylphosphonic acid adenosyl ester: R98 (= R107), I136 (= I145), K138 (= K147), Y144 (= Y153), G146 (= G155), Q149 (= Q158), E175 (= E182), F177 (= F184), V178 (= V185), F180 (= F187), E183 (= E190), H206 (= H213), F249 (= F257), E259 (= E267)
Sites not aligning to the query:
4ma5A The crystal structure of phosphoribosylaminoimidazole carboxylase atpase subunit of francisella tularensis subsp. Tularensis schu s4 in complex with an atp analog, amp-pnp.
41% identity, 96% coverage: 11:351/357 of query aligns to 3:338/363 of 4ma5A
- active site: Y144 (= Y153), G146 (= G155), E247 (= E255), E257 (= E267), N264 (= N274), S265 (= S275), K333 (= K346)
- binding phosphoaminophosphonic acid-adenylate ester: I136 (= I145), K138 (= K147), D145 (= D154), G146 (= G155), F177 (= F184), V178 (= V185), E183 (= E190), H206 (= H213), E247 (= E255), F249 (= F257), N256 (= N266), E257 (= E267), H263 (= H273)
P09029 N5-carboxyaminoimidazole ribonucleotide synthase; N5-CAIR synthase; 5-(carboxyamino)imidazole ribonucleotide synthetase; EC 6.3.4.18 from Escherichia coli (strain K12) (see 2 papers)
40% identity, 96% coverage: 11:351/357 of query aligns to 4:319/355 of P09029
- R80 (= R107) binding
- K120 (= K147) binding
- 125:131 (vs. 152:158, 86% identical) binding
- EQGI 153:156 (≠ EGFV 182:185) binding
- E161 (= E190) binding
- H184 (= H213) binding
- NE 237:238 (= NE 266:267) binding
3ethA Crystal structure of e. Coli purk in complex with mgatp (see paper)
40% identity, 96% coverage: 11:351/357 of query aligns to 4:319/355 of 3ethA
- active site: Y126 (= Y153), G128 (= G155), E226 (= E255), E238 (= E267), N245 (= N274), S246 (= S275), K314 (= K346)
- binding adenosine-5'-triphosphate: R80 (= R107), I118 (= I145), K120 (= K147), Y126 (= Y153), D127 (= D154), G128 (= G155), Q131 (= Q158), I156 (≠ V185), F158 (= F187), E161 (= E190), H184 (= H213), E226 (= E255), F228 (= F257), N237 (= N266), E238 (= E267)
- binding magnesium ion: E226 (= E255), E238 (= E267)
1b6sB Structure of n5-carboxyaminoimidazole ribonucleotide synthetase (see paper)
40% identity, 96% coverage: 11:351/357 of query aligns to 4:319/355 of 1b6sB
- active site: Y126 (= Y153), G128 (= G155), E226 (= E255), E238 (= E267), N245 (= N274), S246 (= S275), K314 (= K346)
- binding adenosine-5'-diphosphate: R80 (= R107), I118 (= I145), K120 (= K147), Y126 (= Y153), D127 (= D154), G128 (= G155), Q131 (= Q158), I156 (≠ V185), F158 (= F187), E161 (= E190), F228 (= F257), N237 (= N266), E238 (= E267)
- binding magnesium ion: E226 (= E255), E238 (= E267)
3ax6A Crystal structure of n5-carboxyaminoimidazole ribonucleotide synthetase from thermotoga maritima
35% identity, 94% coverage: 22:355/357 of query aligns to 15:339/360 of 3ax6A
- active site: E231 (= E255), E244 (= E267), N251 (= N274), S252 (= S275), K330 (= K346)
- binding adenosine-5'-diphosphate: K101 (≠ R107), V136 (≠ I145), K138 (= K147), E164 (= E182), F166 (= F184), V167 (= V185), E172 (= E190), F233 (= F257), N243 (= N266)
1b6rA N5-carboxyaminoimidazole ribonucleotide synthetase from e. Coli (see paper)
39% identity, 96% coverage: 11:351/357 of query aligns to 4:313/349 of 1b6rA
3k5iA Crystal structure of n5-carboxyaminoimidazole synthase from aspergillus clavatus in complex with adp and 5-aminoimadazole ribonucleotide (see paper)
31% identity, 92% coverage: 21:349/357 of query aligns to 17:356/381 of 3k5iA
- active site: E254 (= E255), E267 (= E267), N274 (= N274), S275 (= S275), K353 (= K346)
- binding adenosine-5'-diphosphate: K104 (≠ R107), K146 (= K147), Y152 (= Y153), D153 (= D154), G154 (= G155), W183 (≠ F184), A184 (≠ V185), F186 (= F187), E189 (= E190), Q211 (≠ H213), S214 (≠ G216), E267 (= E267)
- binding 5-aminoimidazole ribonucleotide: E73 (= E76), I74 (≠ F77), Y152 (= Y153), D153 (= D154), R155 (≠ K156), R271 (= R271), K345 (= K338), R352 (= R345)
- binding magnesium ion: E254 (= E255), E267 (= E267)
Sites not aligning to the query:
3k5hA Crystal structure of carboxyaminoimidazole ribonucleotide synthase from asperigillus clavatus complexed with atp (see paper)
31% identity, 92% coverage: 21:349/357 of query aligns to 17:356/382 of 3k5hA
- active site: Y152 (= Y153), G154 (= G155), E254 (= E255), E267 (= E267), N274 (= N274), S275 (= S275), K353 (= K346)
- binding adenosine-5'-triphosphate: K104 (≠ R107), K146 (= K147), Y152 (= Y153), D153 (= D154), G154 (= G155), N157 (≠ Q158), E181 (= E182), W183 (≠ F184), A184 (≠ V185), F186 (= F187), E189 (= E190), E254 (= E255), F256 (= F257), E267 (= E267)
- binding magnesium ion: E254 (= E255), E267 (= E267)
1kjjA Crystal structure of glycniamide ribonucleotide transformylase in complex with mg-atp-gamma-s (see paper)
30% identity, 97% coverage: 5:350/357 of query aligns to 7:361/386 of 1kjjA
- active site: E114 (≠ L108), K154 (= K147), S159 (≠ Y153), G161 (= G155), E261 (= E255), E273 (= E267), D280 (≠ N274), T281 (≠ S275), R357 (≠ K346)
- binding phosphothiophosphoric acid-adenylate ester: R113 (= R107), I152 (= I145), K154 (= K147), S159 (≠ Y153), S160 (≠ D154), G161 (= G155), Q164 (= Q158), E189 (= E182), V192 (= V185), E197 (= E190), Q219 (≠ H213), E261 (= E255), F263 (= F257), E273 (= E267)
- binding magnesium ion: E261 (= E255), E273 (= E267)
1kj8A Crystal structure of purt-encoded glycinamide ribonucleotide transformylase in complex with mg-atp and gar (see paper)
30% identity, 97% coverage: 5:350/357 of query aligns to 7:361/386 of 1kj8A
- active site: E114 (≠ L108), K154 (= K147), S159 (≠ Y153), G161 (= G155), E261 (= E255), E273 (= E267), D280 (≠ N274), T281 (≠ S275), R357 (≠ K346)
- binding adenosine-5'-triphosphate: R113 (= R107), I152 (= I145), K154 (= K147), S159 (≠ Y153), S160 (≠ D154), G161 (= G155), Q164 (= Q158), E189 (= E182), V192 (= V185), F194 (= F187), E197 (= E190), Q219 (≠ H213), G222 (= G216), E261 (= E255), F263 (= F257), E273 (= E267)
- binding glycinamide ribonucleotide: G20 (= G17), E21 (≠ Q18), L22 (= L19), E81 (= E76), I82 (≠ F77), S160 (≠ D154), D280 (≠ N274), K349 (= K338), R356 (= R345)
- binding magnesium ion: E261 (= E255), E273 (= E267)
Query Sequence
>3607265 Dshi_0680 phosphoribosylaminoimidazole carboxylase, ATPase subunit (RefSeq)
MTEPLAPGAVIGMLGGGQLGRMLSMAAARLGFRCHIFEPGAAPPAGQVAEAVTTAGYDDL
DALRRFAEVVDVITYEFENIPTAALDVLEALRPIHPGRRALAVSQDRLTEKEFLRGLGLQ
TAPFAPVDDAAGLEAALAAIGTPAILKTRRLGYDGKGQTRLTAPGDAAEALAAMAGAPAI
LEGFVEFSHEVSVIAARGQDGAVACFDPGENVHRDGILATTTVPARLSHAQRTDAVLLAG
RILNALDYVGVMGVELFVTRGGLIVNEIAPRVHNSGHWTQTGCVIDQFEQHIRAVAGWPL
GDGQRHADVVMENLIGSDMDRVPELAAARDVALHLYGKAETRAGRKMGHANRIMRPG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory