Comparing 3607282 FitnessBrowser__Dino:3607282 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4mncA Crystal structure of a trap periplasmic solute binding protein from polaromonas sp. Js666 (bpro_4736), target efi-510156, with bound benzoyl formate, space group p21 (see paper)
34% identity, 90% coverage: 25:328/336 of query aligns to 4:297/305 of 4mncA
4pe3A Crystal structure of a trap periplasmic solute binding protein from rhodobacter sphaeroides (rsph17029_3620, target efi-510199), apo open structure (see paper)
26% identity, 87% coverage: 45:335/336 of query aligns to 22:312/315 of 4pe3A
2hzlB Crystal structures of a sodium-alpha-keto acid binding subunit from a trap transporter in its closed forms (see paper)
24% identity, 88% coverage: 31:327/336 of query aligns to 11:328/337 of 2hzlB
Q3J1R2 Alpha-keto acid-binding periplasmic protein TakP; Extracytoplasmic solute receptor protein TakP; TRAP transporter alpha-keto acid-binding subunit P; TRAP-T family sorbitol/mannitol transporter, periplasmic binding protein, SmoM from Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.) (Rhodobacter sphaeroides) (see paper)
24% identity, 90% coverage: 25:327/336 of query aligns to 33:356/365 of Q3J1R2
5i7iB Crystal structure of a marine metagenome trap solute binding protein specific for aromatic acid ligands (sorcerer ii global ocean sampling expedition, unidentified microbe, locus tag gos_1523157) in complex with co-crystallized 3-hydroxybenzoate
26% identity, 70% coverage: 22:257/336 of query aligns to 1:241/320 of 5i7iB
5izzA Crystal structure of a marine metagenome trap solute binding protein specific for aromatic acid ligands (sorcerer ii global ocean sampling expedition, unidentified microbe, locus tag gos_1523157, triple surface mutant k158a_k223a_k313a) in complex with metahydroxyphenylacetate, thermal exchange of ligand
25% identity, 70% coverage: 24:257/336 of query aligns to 1:239/318 of 5izzA
7nswBBB TRAP dicarboxylate transporter-DctP subunit (see paper)
24% identity, 69% coverage: 21:253/336 of query aligns to 2:238/328 of 7nswBBB
7ntdAAA TRAP dicarboxylate transporter-DctP subunit (see paper)
24% identity, 68% coverage: 25:253/336 of query aligns to 4:236/322 of 7ntdAAA
Q5SK82 Lactate-binding periplasmic protein TTHA0766; ABC transporter, solute-binding protein; Extracytoplasmic solute receptor protein TTHA0766; TRAP transporter lactate-binding subunit P from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
23% identity, 80% coverage: 42:309/336 of query aligns to 52:330/361 of Q5SK82
Sites not aligning to the query:
2zzwA Crystal structure of a periplasmic substrate binding protein in complex with zinc and lactate (see paper)
23% identity, 80% coverage: 42:309/336 of query aligns to 21:299/330 of 2zzwA
2zzvA Crystal structure of a periplasmic substrate binding protein in complex with calcium and lactate (see paper)
23% identity, 80% coverage: 42:309/336 of query aligns to 21:299/330 of 2zzvA
4n6dA Crystal structure of a trap periplasmic solute binding protein from desulfovibrio salexigens dsm2638 (desal_3247), target efi-510112, phased with i3c, open complex, c-terminus of symmetry mate bound in ligand binding site (see paper)
26% identity, 53% coverage: 80:256/336 of query aligns to 64:231/319 of 4n6dA
Sites not aligning to the query:
4p56B Crystal structure of a trap periplasmic solute binding protein from bordetella bronchiseptica, target efi-510038 (bb2442), with bound (r)-mandelate and (s)-mandelate (see paper)
26% identity, 81% coverage: 33:305/336 of query aligns to 12:282/317 of 4p56B
4p56A Crystal structure of a trap periplasmic solute binding protein from bordetella bronchiseptica, target efi-510038 (bb2442), with bound (r)-mandelate and (s)-mandelate (see paper)
26% identity, 81% coverage: 33:305/336 of query aligns to 11:281/315 of 4p56A
4yicA Crystal structure of a trap transporter solute binding protein (ipr025997) from bordetella bronchiseptica rb50 (bb0280, target efi- 500035) with bound picolinic acid
23% identity, 77% coverage: 44:303/336 of query aligns to 26:288/344 of 4yicA
Sites not aligning to the query:
4napD Crystal structure of a trap periplasmic solute binding protein from desulfovibrio alaskensis g20 (dde_0634), target efi-510102, with bound d-tryptophan (see paper)
24% identity, 63% coverage: 80:292/336 of query aligns to 63:267/310 of 4napD
Sites not aligning to the query:
4pgpA Crystal structure of a trap periplasmic solute binding protein from desulfovibrio alaskensis g20 (dde_0634, target efi-510120) with bound 3-indole acetic acid (see paper)
24% identity, 63% coverage: 80:292/336 of query aligns to 63:267/308 of 4pgpA
Sites not aligning to the query:
4pgnA Crystal structure of a trap periplasmic solute binding protein from desulfovibrio alaskensis g20 (dde_0634, target efi-510120) with bound indole pyruvate (see paper)
24% identity, 63% coverage: 80:292/336 of query aligns to 63:267/308 of 4pgnA
Sites not aligning to the query:
4pfbA Crystal structure of a trap periplasmic solute binding protein from fusobacterium nucleatun (fn1258, target efi-510120) with bound sn- glycerol-3-phosphate (see paper)
25% identity, 43% coverage: 161:304/336 of query aligns to 139:283/308 of 4pfbA
Sites not aligning to the query:
4petA Crystal structure of a trap periplasmic solute binding protein from colwellia psychrerythraea (cps_0129, target efi-510097) with bound calcium and pyruvate (see paper)
26% identity, 56% coverage: 67:253/336 of query aligns to 51:236/329 of 4petA
>3607282 FitnessBrowser__Dino:3607282
MKHYVLSGALAAGLGLGGAAQATETLTAVHAFPTTLIYTQSFLEFVDKVNAAGEGVVQIE
VRGGPEAIGMFQQPDAVRDGIVDMVYTPGSFYGGTVPEKDAMVASNLTAVEARENGGTDL
MNQIHQEKMGVYYLGWFDSGVSYNLWTKDEPQFEENGDLSVEGIKLRGNAVYNAFFTEYL
GAQVIDLPTTDVYAALERGVVDATGWTQIGLIDLKWNEFLNYRIEPNFFSTDLGVIVNLE
KWESLSDEAKTILQDVAIQHERDSVEALRAKRDADFAALEEGGMQVVSLEGEAKERYLAA
AREKTWERMRGLMAEHPSGDGNYDTLISLYYDPALD
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory