Comparing 3607321 FitnessBrowser__Dino:3607321 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 19 hits to proteins with known functional sites (download)
4jwpA Crystal structure of ribosomal-protein-alanine n-acetyltransferase from brucella melitensis in complex with acetyl coa
38% identity, 100% coverage: 1:161/161 of query aligns to 5:165/165 of 4jwpA
4mbuA Crystal structure of n-acetyltransferase from staphylococcus aureus mu50 (see paper)
38% identity, 97% coverage: 1:156/161 of query aligns to 4:159/165 of 4mbuA
3dr8A Structure of ynca, a putative acetyltransferase from salmonella typhimurium with its cofactor acetyl-coa
36% identity, 99% coverage: 2:161/161 of query aligns to 5:164/173 of 3dr8A
Q8ZPD3 L-methionine sulfoximine/L-methionine sulfone acetyltransferase; L-amino acid N-acyltransferase; Methionine derivative detoxifier A; MDDA; EC 2.3.1.-; EC 2.3.1.- from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
36% identity, 99% coverage: 2:161/161 of query aligns to 3:162/171 of Q8ZPD3
A6VCX3 L-methionine sulfoximine/L-methionine sulfone acetyltransferase; Methionine derivative detoxifier A; MDDA; EC 2.3.1.- from Pseudomonas aeruginosa (strain PA7) (see paper)
37% identity, 99% coverage: 2:161/161 of query aligns to 5:165/172 of A6VCX3
2j8mA Structure of p. Aeruginosa acetyltransferase pa4866 (see paper)
37% identity, 99% coverage: 2:161/161 of query aligns to 4:164/171 of 2j8mA
2j8rA Structure of p. Aeruginosa acetyltransferase pa4866 solved in complex with l-methionine sulfoximine (see paper)
37% identity, 99% coverage: 2:161/161 of query aligns to 3:163/170 of 2j8rA
2jlmF Structure of a putative acetyltransferase (aciad1637) from acinetobacter baylyi adp1 (see paper)
31% identity, 93% coverage: 5:153/161 of query aligns to 13:163/180 of 2jlmF
4jxrB Crystal structure of a gnat superfamily phosphinothricin acetyltransferase (pat) from sinorhizobium meliloti in complex with accoa
29% identity, 99% coverage: 2:161/161 of query aligns to 5:165/185 of 4jxrB
5dwnA Crystal structure of phosphinothricin n-acetyltransferase from brucella ovis in complex with acetylcoa
33% identity, 98% coverage: 1:157/161 of query aligns to 5:163/181 of 5dwnA
6m7gA Crystal structure of arsn, n-acetyltransferase with substrate phosphinothricin from pseudomonas putida kt2440 (see paper)
25% identity, 95% coverage: 2:154/161 of query aligns to 4:155/176 of 6m7gA
5wphA Crystal structure of arsn, n-acetyltransferase with substrate ast from pseudomonas putida kt2440 (see paper)
25% identity, 95% coverage: 2:154/161 of query aligns to 4:155/179 of 5wphA
5t7dA Crystal structure of streptomyces hygroscopicus bialaphos resistance (bar) protein in complex with acetyl coenzyme a (see paper)
29% identity, 95% coverage: 2:154/161 of query aligns to 3:154/173 of 5t7dA
5t7eD Crystal structure of streptomyces hygroscopicus bialaphos resistance (bar) protein in complex with coenzyme a and l-phosphinothricin (see paper)
29% identity, 95% coverage: 2:154/161 of query aligns to 4:155/175 of 5t7eD
P0A944 [Ribosomal protein bS18]-alanine N-acetyltransferase; KAT; Peptidyl-lysine N-acetyltransferase; EC 2.3.1.266; EC 2.3.1.- from Escherichia coli (strain K12) (see paper)
41% identity, 40% coverage: 83:146/161 of query aligns to 68:130/148 of P0A944
Q8ZJW4 [Ribosomal protein bS18]-alanine N-acetyltransferase; EC 2.3.1.266 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
41% identity, 40% coverage: 83:146/161 of query aligns to 68:130/148 of Q8ZJW4
2cnsA Rimi - ribosomal s18 n-alpha-protein acetyltransferase in complex with acetylcoa. (see paper)
41% identity, 40% coverage: 83:146/161 of query aligns to 68:130/151 of 2cnsA
Sites not aligning to the query:
2cnmA Rimi - ribosomal s18 n-alpha-protein acetyltransferase in complex with a bisubstrate inhibitor (cterm-arg-arg-phe-tyr-arg-ala-n-alpha- acetyl-s-coa). (see paper)
41% identity, 40% coverage: 83:146/161 of query aligns to 68:130/151 of 2cnmA
Sites not aligning to the query:
2cy2A Crystal structure of ttha1209 in complex with acetyl coenzyme a
32% identity, 65% coverage: 30:134/161 of query aligns to 39:144/174 of 2cy2A
Sites not aligning to the query:
>3607321 FitnessBrowser__Dino:3607321
MIRPATQDDAAQIAALWSALIRDTTVTFNSHEKTAADITALLADKAAADQPFLVALHAGR
VAGFATYGPFRNGPGYARTIEHSILLDTAARGQGLGRGLMSALEDHARTRGMHTLWAGVS
GENPAGVTFHRHLGFAEVATLREVGYKFGRWIDLVLMCKRL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory