SitesBLAST
Comparing 3607421 FitnessBrowser__Dino:3607421 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8oqsB Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-83
42% identity, 97% coverage: 2:715/737 of query aligns to 14:733/735 of 8oqsB
- binding 4-phenylbenzenesulfonic acid: M16 (= M4), P17 (≠ T5), M45 (= M31), I50 (≠ F36), G82 (= G67), G83 (≠ M68), D84 (= D69), T87 (≠ V72), T87 (≠ V72), M88 (≠ I73), M88 (≠ I73), A91 (≠ M76), D95 (= D79), D98 (= D82), V99 (≠ L88), T102 (≠ G91), T102 (≠ G91), E134 (= E132), E156 (= E154), L159 (≠ V157), F302 (= F293), F302 (= F293), F319 (= F310), S456 (= S446), T457 (= T447), M485 (= M475), P486 (≠ L476), G523 (≠ F513), S527 (≠ N517), N535 (= N525), P560 (= P550), M575 (≠ G565), I578 (= I568), I578 (= I568), I682 (= I670), M683 (≠ L671), G686 (= G674)
Sites not aligning to the query:
8oqvA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-109
42% identity, 97% coverage: 2:715/737 of query aligns to 6:725/726 of 8oqvA
- binding 4-nitrobenzenesulfonic acid: E39 (≠ Q33), G74 (= G67), M80 (≠ I73), V91 (≠ L88), T94 (≠ G91), T94 (≠ G91), E148 (= E154), L151 (≠ V157), R182 (≠ L187), S448 (= S446), S519 (≠ N517), R520 (= R518), L562 (≠ T560), L566 (= L564), I570 (= I568)
Sites not aligning to the query:
8oqlA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-1
42% identity, 97% coverage: 4:715/737 of query aligns to 9:726/728 of 8oqlA
- binding Hexafluorophosphate anion: V37 (= V30), N39 (= N32), G75 (= G67), D77 (= D69), M81 (≠ I73), V92 (≠ L88), T95 (≠ G91), P148 (= P153), E149 (= E154), L152 (≠ V157), Q180 (≠ E184), Q260 (≠ K259), K362 (≠ I359), D363 (= D360), V364 (≠ A361), V430 (= V427), D476 (= D473), K477 (= K474), M478 (= M475), P479 (≠ L476), K506 (= K503)
- binding formamide: V78 (≠ L70), K79 (≠ N71)
4b3iA Crystal structure of mycobacterium tuberculosis fatty acid beta-oxidation complex with coenzymea bound at the hydratase active sites (see paper)
42% identity, 97% coverage: 4:715/737 of query aligns to 12:729/731 of 4b3iA
- active site: G79 (≠ M68), E100 (≠ M93), R104 (≠ G97), G127 (≠ I129), E130 (= E132), P151 (= P153), E152 (= E154), G160 (= G162), S452 (= S446), H473 (= H467), E485 (= E479), S523 (≠ N517)
- binding adenosine-5'-diphosphate: Q640 (= Q632), P641 (= P633), P642 (≠ E634), L643 (= L635), Q644 (≠ T636)
- binding coenzyme a: T38 (≠ M28), V40 (= V30), A77 (≠ G66), G79 (≠ M68), D80 (= D69), V81 (≠ L70), E152 (= E154), F315 (= F310), Q319 (≠ E314)
8oqoA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-49
42% identity, 97% coverage: 4:715/737 of query aligns to 9:726/727 of 8oqoA
8pf8A Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-72
42% identity, 97% coverage: 4:715/737 of query aligns to 10:727/729 of 8pf8A
- binding [2-methyl-5-(trifluoromethyl)pyrazol-3-yl]boronic acid: G76 (= G67), F169 (≠ L173), N173 (≠ Q177), S177 (≠ P180), I193 (≠ A196), F313 (= F310)
- binding bis[2-methyl-5-(trifluoromethyl)pyrazol-3-yl]-bis(oxidanyl)boranuide: M39 (= M31), N40 (= N32), E41 (≠ Q33), T81 (≠ V72), D92 (= D82), V93 (≠ L88)
- binding [(2~{R})-2,3-bis(oxidanyl)propoxy]-[2-methyl-5-(trifluoromethyl)pyrazol-3-yl]borinic acid: M39 (= M31), G77 (≠ M68), D78 (= D69), M82 (≠ I73), V93 (≠ L88)
- binding (2~{R})-3-bis[2-methyl-5-(trifluoromethyl)pyrazol-3-yl]boranyloxypropane-1,2-diol: T152 (≠ M156), R184 (≠ L187), A311 (≠ S308), F312 (≠ L309), I673 (≠ V667)
Sites not aligning to the query:
8oquA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-92
42% identity, 97% coverage: 4:715/737 of query aligns to 11:728/730 of 8oquA
- binding 4-chloranylbenzenesulfonic acid: M40 (= M31), N41 (= N32), E42 (≠ Q33), G77 (= G67), G78 (≠ M68), D79 (= D69), V80 (≠ L70), D90 (= D79), V94 (≠ L88), L124 (= L127), G125 (= G128), P150 (= P153), E151 (= E154)
8oqtA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-91
42% identity, 97% coverage: 4:715/737 of query aligns to 10:727/729 of 8oqtA
- binding 4-bromanylbenzenesulfonic acid: E41 (≠ Q33), G76 (= G67), G77 (≠ M68), D78 (= D69), V79 (≠ L70), M82 (≠ I73), D89 (= D79), V93 (≠ L88), T96 (≠ G91), T96 (≠ G91), P149 (= P153), E150 (= E154)
Sites not aligning to the query:
8oqnA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-53
42% identity, 97% coverage: 4:715/737 of query aligns to 10:727/729 of 8oqnA
- binding 1-benzyl-1H-pyrazole-4-carboxylic acid: M39 (= M31), M82 (≠ I73), E150 (= E154), Q172 (≠ M176), F175 (vs. gap), V176 (≠ A179), Q181 (≠ E184), T241 (≠ A239), F254 (≠ A252), N257 (≠ M255), Q261 (≠ K259), L262 (≠ T260), P266 (vs. gap), P268 (= P265), Q282 (≠ M279), V283 (= V280), G302 (≠ N299), Q303 (≠ P300), V304 (≠ S301), S521 (≠ N517), G525 (≠ I521)
8opvA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with resveratrol (fragment-b-h11)
42% identity, 97% coverage: 4:715/737 of query aligns to 10:727/729 of 8opvA
- binding resveratrol: M39 (= M31), A75 (≠ G66), G76 (= G67), M82 (≠ I73), E128 (= E132), P149 (= P153), E150 (= E154), T152 (≠ M156), L153 (≠ V157), R184 (≠ L187), F296 (= F293)
8opuA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with sulfamethoxazole (fragment-b-e1)
42% identity, 97% coverage: 4:715/737 of query aligns to 10:727/729 of 8opuA
8oqrA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-80
42% identity, 97% coverage: 4:715/737 of query aligns to 10:727/728 of 8oqrA
- binding 4-cyanobenzenesulfonic acid: G76 (= G67), G77 (≠ M68), T81 (≠ V72), M82 (≠ I73), M82 (≠ I73), A85 (≠ M76), D89 (= D79), T96 (≠ G91), L123 (= L127), G124 (= G128), P149 (= P153), E150 (= E154), S366 (≠ A362), L367 (≠ Q363), E368 (= E364), A420 (= A416), V421 (= V417), F422 (= F418)
8oqqA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-79
42% identity, 96% coverage: 12:715/737 of query aligns to 14:721/723 of 8oqqA
8oqpA Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-76
42% identity, 96% coverage: 12:715/737 of query aligns to 14:721/723 of 8oqpA
- binding 2-azanyl-5-sulfo-benzoic acid: G28 (≠ K26), S29 (= S27), A63 (≠ G60), K64 (= K61), K64 (= K61), K65 (≠ D62), P143 (= P153), E144 (= E154), L147 (≠ V157), F307 (= F310), M473 (= M475), P548 (= P550), S599 (≠ L598), L602 (≠ K601), K603 (≠ S602), S661 (≠ D661), T662 (≠ I662), G674 (= G674), A698 (= A692), R705 (≠ D699)
7o4uA Structure of the alpha subunit of mycobacterium tuberculosis beta- oxidation trifunctional enzyme in complex with oxidized nicotinamide adenine dinucleotide (see paper)
42% identity, 96% coverage: 12:715/737 of query aligns to 9:709/711 of 7o4uA
6yswA E. Coli anaerobic trifunctional enzyme subunit-alpha in complex with coenzyme a
36% identity, 98% coverage: 7:726/737 of query aligns to 4:703/707 of 6yswA
- active site: A66 (≠ M68), I71 (= I73), A84 (= A85), Q88 (≠ F89), G112 (≠ I129), E115 (= E132), P136 (= P153), E137 (= E154), G145 (= G162), D264 (≠ K287), S422 (= S446), H443 (= H467), E455 (= E479), N493 (= N517)
- binding coenzyme a: E23 (≠ K26), M25 (= M28), A66 (≠ M68), D67 (= D69), I68 (≠ L70), P136 (= P153), E137 (= E154), L140 (≠ V157), T290 (≠ E314), K293 (≠ E317)
P40939 Trifunctional enzyme subunit alpha, mitochondrial; 78 kDa gastrin-binding protein; Monolysocardiolipin acyltransferase; TP-alpha; EC 2.3.1.-; EC 4.2.1.17; EC 1.1.1.211 from Homo sapiens (Human) (see 5 papers)
33% identity, 96% coverage: 16:726/737 of query aligns to 49:762/763 of P40939
- V282 (≠ T248) to D: in MTPD1; mild phenotype with slowly progressive myopathy and sensorimotor polyneuropathy; dbSNP:rs137852773
- I305 (≠ L271) to N: in MTPD1; mild phenotype with slowly progressive myopathy and sensorimotor polyneuropathy; dbSNP:rs137852774
- L342 (= L309) to P: in LCHAD deficiency; dbSNP:rs137852772
- E510 (= E479) active site, For hydroxyacyl-coenzyme A dehydrogenase activity; to Q: in AFLP and LCHAD deficiency; loss of long-chain-3-hydroxyacyl-CoA dehydrogenase activity; dbSNP:rs137852769
1wdlA Fatty acid beta-oxidation multienzyme complex from pseudomonas fragi, form ii (native4) (see paper)
35% identity, 97% coverage: 15:727/737 of query aligns to 16:715/715 of 1wdlA
- active site: A69 (≠ M68), N89 (≠ V92), N93 (≠ H96), G117 (≠ I129), E120 (= E132), P139 (= P153), E140 (= E154), P147 (= P161), G148 (= G162), S430 (= S446), H451 (= H467), E463 (= E479), N501 (= N517)
- binding nicotinamide-adenine-dinucleotide: A322 (= A338), I324 (≠ M340), M325 (= M341), D344 (= D360), I345 (≠ A361), A400 (= A416), V401 (= V417), E403 (= E419), N428 (= N444), T429 (= T445), S430 (= S446)
P28793 Fatty acid oxidation complex subunit alpha; EC 4.2.1.17; EC 5.1.2.3; EC 5.3.3.8; EC 1.1.1.35 from Pseudomonas fragi (see paper)
35% identity, 97% coverage: 15:727/737 of query aligns to 16:715/715 of P28793
1wdmA Fatty acid beta-oxidation multienzyme complex from pseudomonas fragi, form i (native3) (see paper)
35% identity, 97% coverage: 15:727/737 of query aligns to 16:707/707 of 1wdmA
- active site: A69 (≠ M68), N89 (≠ V92), N93 (≠ H96), G117 (≠ I129), E120 (= E132), P139 (= P153), E140 (= E154), P147 (= P161), G148 (= G162), S430 (= S446), H451 (= H467), E463 (= E479), N501 (= N517)
- binding acetyl coenzyme *a: K142 (≠ M156), D297 (≠ K313), M459 (= M475), N501 (= N517), P534 (= P550), Y652 (≠ L671), L658 (≠ P677)
- binding nicotinamide-adenine-dinucleotide: G321 (= G337), A322 (= A338), I324 (≠ M340), M325 (= M341), D344 (= D360), V401 (= V417), E403 (= E419), N428 (= N444), S430 (= S446), N454 (≠ S470)
Query Sequence
>3607421 FitnessBrowser__Dino:3607421
MNDMTDFTMKTDADGVAIITWDVQGKSMNVMNQQGFEDLDALVDKALADDTVKGIIITSG
KDSFAGGMDLNVIAKMRDDAGDDPARGLFEGVMAMHGILRKIERAGMDPKTNKGGKPVAA
ALPGTALGIGLEIPLACHRIFAADNPKAKIGLPEIMVGIFPGAGGTMRVSRKLGAMQAAP
ILLEGKLFEPKKAKMAGIVDEVVPAEELLDAAKAWVLSAKDTDIVKPWDLKGYKFPGGAP
YHPAGFMTFVGASAMIHSKTMGVYPAAKALLSAVYEGAMVPFDTALKIEARWFTNVLMNP
SSSAMIRSLFINKEALEKGAVRPDVPDQKVKKVGILGAGMMGAGIAYVSANAGIEVVLID
AAQESADRGKAHAAGILDKGIARKKVTPEKKDEVLARITATTDYAALEGCDLVVEAVFED
PGVKAEVTAKAEAVIPGDAIFATNTSTLPISELAKASARPEQFIGIHFFSPVDKMLLVEI
IKGRQTGDVAVAKALDFVRQIRKTPIVVNDARFFYANRCIIPYINEGIRMVAEGVTPALV
ENAAKLVGMPLGPLQLVDETSIDLGVKIAKATKAAMGDAYPDGAVDEVLFWMADEGRLGR
KSNAGFYTYDEAGKRGLLWEGLADRYPAAKEQPELTAVQHRLLMAQVLEAVRALEDGVLM
DIREGDVGAILGWGFAPWSGGPLSWLDMIGAARAVEICDALTDTHGARFTTPALLREMAE
KGETFYGRFGAETRKAA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory