Comparing 3607452 FitnessBrowser__Dino:3607452 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 19 hits to proteins with known functional sites (download)
8gy3C Cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans
29% identity, 94% coverage: 42:721/727 of query aligns to 8:718/732 of 8gy3C
5g5gC Escherichia coli periplasmic aldehyde oxidase (see paper)
28% identity, 58% coverage: 192:615/727 of query aligns to 13:462/731 of 5g5gC
Sites not aligning to the query:
P77489 Aldehyde oxidoreductase molybdenum-binding subunit PaoC; EC 1.2.99.6 from Escherichia coli (strain K12) (see 2 papers)
27% identity, 58% coverage: 192:615/727 of query aligns to 13:462/732 of P77489
Sites not aligning to the query:
5y6qC Crystal structure of an aldehyde oxidase from methylobacillus sp. Ky4400 (see paper)
27% identity, 43% coverage: 266:578/727 of query aligns to 109:409/748 of 5y6qC
Sites not aligning to the query:
3hrdB Crystal structure of nicotinate dehydrogenase (see paper)
37% identity, 17% coverage: 596:721/727 of query aligns to 183:316/330 of 3hrdB
Sites not aligning to the query:
Q0QLF1 Nicotinate dehydrogenase medium molybdopterin subunit; NDH; Nicotinic acid hydroxylase medium molybdopterin subunit; NAH; EC 1.17.1.5 from Eubacterium barkeri (Clostridium barkeri) (see paper)
37% identity, 17% coverage: 596:721/727 of query aligns to 183:316/330 of Q0QLF1
Sites not aligning to the query:
1rm6A Structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica (see paper)
36% identity, 17% coverage: 596:722/727 of query aligns to 614:746/761 of 1rm6A
Sites not aligning to the query:
O33819 4-hydroxybenzoyl-CoA reductase subunit alpha; 4-HBCR subunit alpha; EC 1.1.7.1 from Thauera aromatica (see paper)
36% identity, 17% coverage: 596:722/727 of query aligns to 622:754/769 of O33819
Sites not aligning to the query:
7dqxD Crystal structure of xanthine dehydrogenase family protein
27% identity, 42% coverage: 255:557/727 of query aligns to 102:397/770 of 7dqxD
Sites not aligning to the query:
1t3qB Crystal structure of quinoline 2-oxidoreductase from pseudomonas putida 86 (see paper)
21% identity, 51% coverage: 184:553/727 of query aligns to 5:401/786 of 1t3qB
Sites not aligning to the query:
3zyvB Crystal structure of the mouse liver aldehyde oxidase 3 (maox3) (see paper)
25% identity, 43% coverage: 239:553/727 of query aligns to 581:891/1262 of 3zyvB
Sites not aligning to the query:
G3X982 Aldehyde oxidase 3; Aldehyde oxidase homolog 1; Azaheterocycle hydroxylase 3; EC 1.2.3.1; EC 1.17.3.- from Mus musculus (Mouse) (see paper)
27% identity, 33% coverage: 315:553/727 of query aligns to 719:947/1335 of G3X982
Sites not aligning to the query:
2w54B Crystal structure of xanthine dehydrogenase from rhodobacter capsulatus in complex with bound inhibitor pterin-6-aldehyde (see paper)
28% identity, 34% coverage: 316:561/727 of query aligns to 146:379/760 of 2w54B
Sites not aligning to the query:
2w3sB Crystal structure of xanthine dehydrogenase (desulfo form) from rhodobacter capsulatus in complex with xanthine (see paper)
28% identity, 34% coverage: 316:561/727 of query aligns to 146:379/760 of 2w3sB
Sites not aligning to the query:
2w3rB Crystal structure of xanthine dehydrogenase (desulfo form) from rhodobacter capsulatus in complex with hypoxanthine (see paper)
28% identity, 34% coverage: 316:561/727 of query aligns to 146:379/760 of 2w3rB
Sites not aligning to the query:
1jrpB Crystal structure of xanthine dehydrogenase inhibited by alloxanthine from rhodobacter capsulatus (see paper)
28% identity, 34% coverage: 316:561/727 of query aligns to 146:379/760 of 1jrpB
Sites not aligning to the query:
1jroB Crystal structure of xanthine dehydrogenase from rhodobacter capsulatus (see paper)
28% identity, 34% coverage: 316:561/727 of query aligns to 146:379/760 of 1jroB
Sites not aligning to the query:
4zohA Crystal structure of glyceraldehyde oxidoreductase (see paper)
28% identity, 17% coverage: 597:720/727 of query aligns to 564:694/701 of 4zohA
Sites not aligning to the query:
1dgjA Crystal structure of the aldehyde oxidoreductase from desulfovibrio desulfuricans atcc 27774 (see paper)
30% identity, 20% coverage: 574:720/727 of query aligns to 745:895/906 of 1dgjA
Sites not aligning to the query:
>3607452 FitnessBrowser__Dino:3607452
MLHYLDTALAAPRPSRRAFLKLSAGAVGGLLLGGALPRAAQAMGDDALAQPFVHITPDNV
VTVLVKHQDMGQGAATGLATLVAEELDASPDQIAVEFAPSNPQVYANSLFGVQGTGGSTA
MRNSFTQYREAGASARAMLVAAAAQAWGVAPEAVTVADGTLSSGANSASFGDMASAAAAQ
PVPEAVTLKRADQWRLIGKDMARVEIPAKTRGSVGLFGMDAKPEGALIAVTARPPRFGAT
VASVDAEAARAMPGVQAVLTIPQGVVVVADNTWRAMQARDALEIEWDMSGAETRGTEEIT
AEFEALLDQPGLPAVARGDAAGKLAGAAQVVEARYHFPYLAHAPMEPLNMTVLFDGERAT
LWGGSQIQTIDHNVAAGVLGIPFENVAINTMWGGGSFGRRATADGHLVAEAATIAAAWLG
ETGRPAPIKLVYTREDDIKGGYYRPLTLHKVRAGVDAEGNIAGWAHRVVGQGIMIGTPFE
EFLVKDGVDHSSVEGAADTTYSLPDMAMDVHHPSAGVPVLWWRAVGHTHTAYVMETMMDA
LAEAAGRDPVEFRLAHLGDDPRLAGVLRLAAEKGGWDSPAPEGIHRGVAVHKSFESYVAE
VAEVRIREDGTVKVEKVTCAVDCGVAINPDNIVAQIEGGLAYGLSGILREEITMTDGAVD
QSNYPDYAALRIADMPRVEVHIVPSTEGPSGVGEPGTPPIGPAVANAVARATGQRITVLP
FSKHGLA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory