Comparing 3607471 FitnessBrowser__Dino:3607471 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0AAH4 Putrescine export system ATP-binding protein SapD from Escherichia coli (strain K12) (see paper)
36% identity, 88% coverage: 4:320/360 of query aligns to 2:326/330 of P0AAH4
Q8RDH4 Dipeptide transport ATP-binding protein DppD; EC 7.4.2.9 from Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) (Thermoanaerobacter tengcongensis) (see paper)
38% identity, 88% coverage: 5:321/360 of query aligns to 4:322/326 of Q8RDH4
4fwiB Crystal structure of the nucleotide-binding domain of a dipeptide abc transporter (see paper)
38% identity, 86% coverage: 5:315/360 of query aligns to 3:305/310 of 4fwiB
Sites not aligning to the query:
7z15I E. Coli c-p lyase bound to a phnk/phnl dual abc dimer and adp + pi (see paper)
39% identity, 73% coverage: 3:266/360 of query aligns to 1:253/253 of 7z15I
7z18I E. Coli c-p lyase bound to a phnk abc dimer and atp (see paper)
40% identity, 71% coverage: 3:258/360 of query aligns to 1:246/250 of 7z18I
7z16I E. Coli c-p lyase bound to phnk/phnl dual abc dimer with amppnp and phnk e171q mutation (see paper)
39% identity, 71% coverage: 3:258/360 of query aligns to 1:246/250 of 7z16I
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
33% identity, 71% coverage: 5:259/360 of query aligns to 1:244/343 of P30750
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
33% identity, 71% coverage: 5:259/360 of query aligns to 2:245/344 of 6cvlD
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
33% identity, 71% coverage: 5:259/360 of query aligns to 2:245/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
33% identity, 71% coverage: 5:259/360 of query aligns to 2:245/344 of 3tuiC
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
33% identity, 69% coverage: 4:252/360 of query aligns to 1:232/241 of 4u00A
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
33% identity, 66% coverage: 14:252/360 of query aligns to 6:232/240 of 4ymuJ
1f3oA Crystal structure of mj0796 atp-binding cassette (see paper)
32% identity, 66% coverage: 5:241/360 of query aligns to 1:230/232 of 1f3oA
5xu1B Structure of a non-canonical abc transporter from streptococcus pneumoniae r6 (see paper)
33% identity, 63% coverage: 3:228/360 of query aligns to 1:215/226 of 5xu1B
1l2tA Dimeric structure of mj0796, a bacterial abc transporter cassette (see paper)
32% identity, 66% coverage: 5:241/360 of query aligns to 1:230/230 of 1l2tA
3c4jA Abc protein artp in complex with atp-gamma-s
30% identity, 66% coverage: 15:252/360 of query aligns to 9:234/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
30% identity, 66% coverage: 15:252/360 of query aligns to 9:234/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
30% identity, 66% coverage: 15:252/360 of query aligns to 9:234/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
30% identity, 66% coverage: 15:252/360 of query aligns to 9:234/242 of 2oljA
7mdyC Lolcde nucleotide-bound
38% identity, 59% coverage: 25:237/360 of query aligns to 22:224/226 of 7mdyC
Sites not aligning to the query:
>3607471 FitnessBrowser__Dino:3607471
MTQPVLSIRNLTVDIPTRYAVLRPVDKVSYDIAPGEILGVVGESGAGKSMAGNAVIGLLT
PPAHISSGEVWLNGKRIDRLTPEQMRRVRGKDIGMVFQDPLTSLNPLLRIGDQLTETMLA
HLPISRAEAEERAVAALEEVGIPAARQRVNSYPHEFSGGMRQRVVIALALCAEPSLVIAD
EPTTALDVSVQAQIIALLKRLCRERGTAVMLITHDMGVIAEAADRVAVMYAGRLAELGPV
REVLTAPRHPYTFGLMGSTPLASKGLKRLHQIPGSMPRLGRLPPGCAFSPRCPRAQDKCR
HDPGPVIDADGAAACWFPMDGTEGIGGDATPPHGGARHLPDTSPTGARPGADAGFTGGGA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory