SitesBLAST
Comparing 3607478 FitnessBrowser__Dino:3607478 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
D2Z027 O-ureido-L-serine synthase; Cysteine synthase homolog DscD; O-acetylserine sulfhydrylase; EC 2.6.99.3; EC 2.5.1.47 from Streptomyces lavendulae (see paper)
49% identity, 91% coverage: 17:345/360 of query aligns to 4:312/324 of D2Z027
- K43 (= K56) modified: N6-(pyridoxal phosphate)lysine; mutation to A: Loss of catalytic activity, no longer binds N6-(pyridoxal phosphate)lysine.
- V74 (≠ T87) mutation to T: KM for OAS is 61 mM, KM for H(2)S is unchanged.
- Y97 (≠ F110) mutation to F: KM for OAS is unchanged, KM for H(2)S is 0.073 mM.; mutation to M: KM for OAS is 330 mM, KM for H(2)S is 0.084.
- S121 (≠ G134) mutation to A: KM for OAS is 140 mM, KM for H(2)S is 0.095 mM.; mutation to M: KM for OAS is 44 mM, KM for H(2)S is 0.20 mM.
3x43A Crystal structure of o-ureido-l-serine synthase (see paper)
49% identity, 91% coverage: 17:345/360 of query aligns to 3:311/316 of 3x43A
- active site: K42 (= K56), S264 (= S298)
- binding pyridoxal-5'-phosphate: K42 (= K56), N72 (= N86), F175 (≠ Y189), G176 (= G190), T177 (= T191), T178 (≠ G192), T180 (= T194), G220 (= G250), S264 (= S298), P290 (= P324), D291 (= D325)
3x44A Crystal structure of o-ureido-l-serine-bound k43a mutant of o-ureido- l-serine synthase (see paper)
49% identity, 91% coverage: 17:345/360 of query aligns to 3:311/321 of 3x44A
- active site: A42 (≠ K56), S264 (= S298)
- binding (E)-O-(carbamoylamino)-N-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene)-L-serine: T69 (= T83), S70 (= S84), N72 (= N86), V73 (≠ T87), S120 (≠ G134), Q141 (= Q155), F175 (≠ Y189), G176 (= G190), T177 (= T191), T178 (≠ G192), T180 (= T194), G220 (= G250), L221 (≠ W251), P223 (= P253), S264 (= S298), P290 (= P324), D291 (= D325)
P9WP55 O-acetylserine sulfhydrylase; OAS sulfhydrylase; OASS; Cysteine synthase A; CSase A; O-acetylserine (thiol)-lyase A; OAS-TL A; O-acetylserine-specific cysteine synthase; Sulfide-dependent cysteine synthase; EC 2.5.1.47 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
43% identity, 90% coverage: 18:341/360 of query aligns to 5:310/310 of P9WP55
- K44 (= K56) modified: N6-(pyridoxal phosphate)lysine
- N74 (= N86) binding
- GTGGT 178:182 (= GTGGT 190:194) binding
- S266 (= S298) binding
2q3dA 2.2 a resolution crystal structure of o-acetylserine sulfhydrylase (oass) from mycobacterium tuberculosis in complex with the reaction intermediate alpha-aminoacrylate (see paper)
43% identity, 89% coverage: 18:336/360 of query aligns to 5:305/306 of 2q3dA
- active site: K44 (= K56), S266 (= S298), P293 (= P324)
- binding 2-[(3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl)-amino]-propionic acid: K44 (= K56), T71 (= T83), S72 (= S84), N74 (= N86), T75 (= T87), Q144 (= Q155), V177 (≠ Y189), G178 (= G190), T179 (= T191), G180 (= G192), T182 (= T194), G222 (= G250), I223 (≠ W251), S266 (= S298), P293 (= P324), D294 (= D325)
3zeiA Structure of the mycobacterium tuberculosis o-acetylserine sulfhydrylase (oass) cysk1 in complex with a small molecule inhibitor (see paper)
42% identity, 87% coverage: 18:331/360 of query aligns to 5:300/300 of 3zeiA
- active site: K44 (= K56), S266 (= S298), P293 (= P324)
- binding 3-[(Z)-[(5Z)-5-[[2-(2-hydroxy-2-oxoethyloxy)phenyl]methylidene]-3-methyl-4-oxidanylidene-1,3-thiazolidin-2-ylidene]amino]benzoic acid: T71 (= T83), S72 (= S84), I126 (≠ Y138), Q144 (= Q155), F145 (= F156), K215 (≠ F243), G222 (= G250), A225 (≠ P253), F227 (= F255)
- binding pyridoxal-5'-phosphate: K44 (= K56), N74 (= N86), V177 (≠ Y189), G178 (= G190), T179 (= T191), G180 (= G192), T182 (= T194), G222 (= G250), S266 (= S298), P293 (= P324), D294 (= D325)
2q3cA 2.1 a resolution crystal structure of o-acetylserine sulfhydrylase (oass) holoenzyme from mycobacterium tuberculosis in complex with the inhibitory peptide dfsi (see paper)
42% identity, 87% coverage: 18:331/360 of query aligns to 5:300/300 of 2q3cA
- active site: K44 (= K56), S266 (= S298), P293 (= P324)
- binding : T71 (= T83), S72 (= S84), G73 (= G85), T75 (= T87), M122 (≠ G134), Q144 (= Q155), K215 (≠ F243), G222 (= G250), A225 (≠ P253)
5xoqA Crystal structure of o-acetylserine sulfhydrylase with bound transcription factor peptide inhibitor from planctomyces limnophilus
43% identity, 88% coverage: 22:339/360 of query aligns to 10:309/310 of 5xoqA
- binding : T72 (= T83), S73 (= S84), G74 (= G85), T76 (= T87), M123 (≠ G134), Q144 (= Q155), R218 (≠ A235), H219 (= H246), Q222 (= Q249), G223 (= G250), A226 (≠ P253)
P35520 Cystathionine beta-synthase; Beta-thionase; Serine sulfhydrase; EC 4.2.1.22 from Homo sapiens (Human) (see 40 papers)
38% identity, 88% coverage: 15:332/360 of query aligns to 75:383/551 of P35520
- P78 (≠ D18) to R: in CBSD; severe form; associated in cis with N-102; decreased cystathionine beta-synthase activity; decreased homotetramer formation; dbSNP:rs786204608
- G85 (= G25) to R: in CBSD; loss of cystathionine beta-synthase activity; dbSNP:rs863223435
- T87 (= T27) to N: in CBSD; decreased cystathionine beta-synthase activity; increased aggregation
- L101 (vs. gap) to P: in CBSD; common mutation in Irish population; loss of activity; dbSNP:rs786204757
- K102 (≠ G39) to N: in CBSD; associated in cis with R-78; decreased cystathionine beta-synthase activity; decreased homotetramer formation; dbSNP:rs786204609; to Q: in dbSNP:rs34040148
- C109 (≠ A46) to R: in CBSD; loss of activity; dbSNP:rs778220779
- A114 (≠ P51) to V: in CBSD; mild form; when linked with W-58 severe form; decreased cystathionine beta-synthase activity; decreases homotetramer formation by promoting formation of larger aggregates; dbSNP:rs121964964
- K119 (= K56) modified: N6-(pyridoxal phosphate)lysine
- R125 (≠ N62) to Q: in CBSD; severe form; when linked with D-131 moderate form; loss of cystathionine beta-synthase activity; decreased homotetramer formation; dbSNP:rs781444670; to W: in CBSD; exhibits an activity lower than 4% of the wild-type enzyme; absent capacity to form multimeric quaternary structure; dbSNP:rs886057100
- M126 (≠ I63) to V: in CBSD; loss of activity
- E131 (= E68) to D: in CBSD; linked with Q-125; loss of activity; dbSNP:rs1555875351
- G139 (= G76) to R: in CBSD; mild form; dbSNP:rs121964965
- I143 (≠ V80) to M: in CBSD; 4% of activity; stable; dbSNP:rs370167302
- E144 (= E81) to K: in CBSD; loss of cystathionine beta-synthase activity; impaired stimulation by AdoMet and AdoHcy; decreased homotetramer formation; dbSNP:rs121964966
- G148 (= G85) to R: in CBSD; loss of cystathionine beta-synthase activity; impaired stimulation by AdoMet and AdoHcy; loss of homotetramer formation; dbSNP:rs755952006
- N149 (= N86) binding
- L154 (= L91) to Q: in CBSD; protein expression is comparable to wild-type; significant decrease of enzyme activity
- A155 (= A92) to T: in CBSD; complete loss of activity; severely affects homotetramer formation by promoting formation of larger aggregates; dbSNP:rs1429138569; to V: in CBSD; protein expression is comparable to wild-type; significant decrease of enzyme activity
- C165 (≠ L102) to Y: in CBSD; severe form; protein expression is comparable to wild-type; loss of cystathionine beta-synthase activity; no effect on homotetramer formation; dbSNP:rs1347651454
- M173 (≠ F110) to V: in CBSD; presents 40% of the wild-type activity; highly reduced capacity to form multimeric quaternary structure; natural variant: Missing (in CBSD; loss of activity)
- E176 (= E113) to K: in CBSD; severe form; loss of cystathionine beta-synthase activity; inhibited by AdoMet; severely decreases homotetramer formation by promoting formation of larger aggregates; dbSNP:rs762065361
- V180 (≠ L117) to A: in CBSD; decreased cystathionine beta-synthase activity; decreases homotetramer formation; dbSNP:rs1555875010
- T191 (= T128) to M: in CBSD; moderate and severe forms; loss of cystathionine beta-synthase activity; absent capacity to form multimeric quaternary structure; dbSNP:rs121964973
- K211 (≠ A141) modified: Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO)
- A226 (= A159) to T: in CBSD; presents 20% of the wild-type activity; dramatically reduced capacity to form multimeric quaternary structure; dbSNP:rs763835246
- N228 (= N161) to K: in CBSD; loss of cystathionine beta-synthase activity; decreased homotetramer formation; dbSNP:rs1464223176; to S: in CBSD; has significantly decreased levels of enzyme activity; dbSNP:rs1555874803
- A231 (≠ M164) to P: in CBSD; has significantly decreased levels of enzyme activity
- D234 (≠ N167) to N: in CBSD; decreased cystathionine beta-synthase activity; changed localization; decreased interaction with pyridoxal 5'-phosphate; no effect on homotetramer formation; dbSNP:rs773734233; natural variant: Missing (in CBSD; protein expression is comparable to wild-type; significant decrease of enzyme activity)
- GTGGT 256:260 (= GTGGT 190:194) binding
- T257 (= T191) to M: in CBSD; moderate to severe form; protein expression is comparable to wild-type; significant decrease of enzyme activity; dbSNP:rs758236584
- T262 (= T196) to M: in CBSD; moderate form; dbSNP:rs149119723; to R: in CBSD; severe form; loss of cystathionine beta-synthase activity; loss of homotetramer formation
- R266 (= R200) to K: in CBSD; mild form; decreased cystathionine beta-synthase activity; decreased homotetramer formation; no effect on heme-binding; decreased stability; dbSNP:rs121964969
- K269 (≠ R203) natural variant: Missing (in CBSD; loss of expression)
- C272 (≠ R206) mutation to A: Reduced heme content and cystathionine beta-synthase activity.
- C275 (≠ T209) to Y: in CBSD; severe form; exhibits an activity lower than 4% of the wild-type enzyme; absent capacity to form multimeric quaternary structure; mutation to S: Reduced heme content and cystathionine beta-synthase activity.
- I278 (= I212) to S: in CBSD; loss of activity; to T: in CBSD; mild to severe form; common mutation; decreased expression; loss of cystathionine beta-synthase activity; impaired stimulation by AdoMet and AdoHcy; severely affects homotetramer formation by promoting formation of larger aggregates; dbSNP:rs5742905
- D281 (≠ E215) to N: in CBSD; loss of activity
- A288 (= A227) to T: in CBSD; protein expression is comparable to wild-type; significant decrease of enzyme activity; dbSNP:rs141502207
- E302 (≠ S241) to K: in CBSD; no effect on cystathionine beta-synthase activity; inhibited by AdoHcy and impaired activation by AdoMet; no effect on homotetramer formation; dbSNP:rs779270933
- G305 (= G250) to R: in CBSD; loss of cystathionine beta-synthase activity; no effect on homotetramer formation
- G307 (≠ T252) to S: in CBSD; moderate to severe form; linked with D-534; common mutation; loss of cystathionine beta-synthase activity; impaired stimulation by AdoMet and AdoHcy; no effect on homotetramer formation; dbSNP:rs121964962
- V320 (≠ Y269) to A: in CBSD; has 36% of wild-type enzyme activity; dbSNP:rs781567152
- D321 (= D270) to V: in CBSD; loss of activity
- R336 (= R285) to C: in CBSD; protein expression is comparable to wild-type; loss of activity; absent capacity to form multimeric quaternary structure; dbSNP:rs398123151; to H: in CBSD; mild form; no effect on expression; exhibits an activity lower than 4% of the wild-type enzyme; altered stimulation by AdoMet; absent capacity to form multimeric quaternary structure; dbSNP:rs760417941
- L338 (= L287) to P: in CBSD; severe form; exhibits an activity lower than 4% of the wild-type enzyme; absent capacity to form multimeric quaternary structure
- G347 (= G296) to S: in CBSD; protein expression is comparable to wild-type; loss of activity; dbSNP:rs771298943
- S349 (= S298) binding ; to N: in CBSD; severe form; exhibits an activity lower than 4% of the wild-type enzyme; absent capacity to form multimeric quaternary structure
- T353 (= T302) to M: in CBSD; protein expression is comparable to wild-type; significant decrease of enzyme activity; dbSNP:rs121964972
- R369 (≠ V318) to C: in CBSD; when linked with C-491 severe form; decreased cystathionine beta-synthase activity; decreased homotetramer formation; dbSNP:rs117687681
- D376 (= D325) to N: in CBSD; has significantly decreased levels of enzyme activity; dbSNP:rs1170128038
- R379 (≠ E328) to Q: in CBSD; exhibits an activity lower than 4% of the wild-type enzyme; absent capacity to form multimeric quaternary structure; dbSNP:rs763036586
Sites not aligning to the query:
- 18 R → C: results in 1/3 to 2/3 the enzyme activity of the wild-type; dbSNP:rs201827340
- 49 P → L: in CBSD; decreased expression; no effect on cystathionine beta-synthase activity; increased homotetramer formation; dbSNP:rs148865119
- 52 binding axial binding residue
- 58 R → W: in CBSD; linked with V-114; 18% of activity; dbSNP:rs555959266
- 65 binding axial binding residue; H → R: in CBSD; decreased cystathionine beta-synthase activity; inhibited by AdoMet and AdoHcy; decreased homotetramer formation; dbSNP:rs1191141364
- 69 A → P: in dbSNP:rs17849313
- 384 K → E: in CBSD; severe form; dbSNP:rs121964967
- 422 P → L: in CBSD; changed cystathionine beta-synthase activity; impaired stimulation by AdoMet; does not affect homotetramer formation; dbSNP:rs28934892
- 427 P → L: in CBSD; no effect on cystathionine beta-synthase activity; altered stimulation by AdoMet; dbSNP:rs863223434
- 435 I → T: in CBSD; no effect on cystathionine beta-synthase activity; impaired stimulation by AdoMet and AdoHcy; does not affect homotetramer formation
- 439 R → Q: in CBSD; no effect on cystathionine beta-synthase activity; increased homotetramer formation; dbSNP:rs756467921
- 444 D → N: in CBSD; decreased expression; no effect on cystathionine beta-synthase activity; altered stimulation by AdoMet; increased homotetramer formation; dbSNP:rs28934891
- 449 V → G: in CBSD; no effect on cystathionine beta-synthase activity; altered stimulation by AdoMet
- 456 L → P: in CBSD; severe; exhibits an activity lower than 4% of the wild-type enzyme; absent capacity to form multimeric quaternary structure
- 466 S → L: in CBSD; increased cystathionine beta-synthase activity; impaired stimulation by AdoMet and AdoHcy; decreased homotetramer formation; dbSNP:rs121964971
- 500 S → L: in CBSD; no effect on cystathionine beta-synthase activity; altered stimulation by AdoMet; dbSNP:rs755106884
- 526 Q → K: in CBSD; has significantly decreased levels of enzyme activity
- 539 L → S: in CBSD; loss of cystathionine beta-synthase activity; impaired stimulation by AdoMet and AdoHcy; loss of homotetramer formation; dbSNP:rs121964968
- 540 L → Q: in CBSD; no effect on cystathionine beta-synthase activity; altered stimulation by AdoMet
- 548 R → Q: presents 60% of the wild-type activity; highly reduced capacity to form multimeric quaternary structure; dbSNP:rs150828989
7qgtB Crystal structure of human cystathionine beta-synthase (delta516-525) in complex with aoaa. (see paper)
38% identity, 89% coverage: 15:335/360 of query aligns to 35:346/500 of 7qgtB
- binding protoporphyrin ix containing fe: A186 (= A159), P189 (≠ A162), L190 (≠ E163), Y193 (≠ E166), R226 (= R200)
- binding 4'-deoxy-4'-acetylyamino-pyridoxal-5'-phosphate: K79 (= K56), T106 (= T83), S107 (= S84), N109 (= N86), T110 (= T87), Q182 (= Q155), G216 (= G190), T217 (= T191), G218 (= G192), T220 (= T194), G265 (= G250), S309 (= S298), P335 (= P324), D336 (= D325)
Sites not aligning to the query:
7qgtA Crystal structure of human cystathionine beta-synthase (delta516-525) in complex with aoaa. (see paper)
38% identity, 89% coverage: 15:335/360 of query aligns to 35:346/500 of 7qgtA
- binding protoporphyrin ix containing fe: A186 (= A159), P189 (≠ A162), L190 (≠ E163), Y193 (≠ E166), R226 (= R200)
- binding pyridoxal-5'-phosphate: K79 (= K56), N109 (= N86), G216 (= G190), T217 (= T191), G218 (= G192), T220 (= T194), G265 (= G250), S309 (= S298), P335 (= P324), D336 (= D325)
Sites not aligning to the query:
4pcuA Crystal structure of delta516-525 e201s human cystathionine beta- synthase with adomet (see paper)
38% identity, 89% coverage: 15:335/360 of query aligns to 33:342/486 of 4pcuA
- active site: K77 (= K56), S105 (= S84), D237 (≠ E215), S305 (= S298)
- binding protoporphyrin ix containing fe: A182 (= A159), P185 (≠ A162), L186 (≠ E163), Y189 (≠ E166), R222 (= R200), T269 (≠ K258)
- binding pyridoxal-5'-phosphate: K77 (= K56), N107 (= N86), G212 (= G190), T213 (= T191), G214 (= G192), T216 (= T194), G261 (= G250), S305 (= S298), P331 (= P324), D332 (= D325)
Sites not aligning to the query:
- binding protoporphyrin ix containing fe: 8, 9, 10, 11, 12, 20, 21, 22, 23
- binding s-adenosylmethionine: 376, 396, 397, 398, 399, 476, 478, 479
4lmaA Crystal structure analysis of o-acetylserine sulfhydrylase cysk1 from microcystis aeruginosa 7806 (see paper)
39% identity, 91% coverage: 15:341/360 of query aligns to 2:313/318 of 4lmaA
4aecA Crystal structure of the arabidopsis thaliana o-acetyl-serine-(thiol)- lyasE C (see paper)
39% identity, 94% coverage: 7:343/360 of query aligns to 2:323/323 of 4aecA
- active site: K54 (= K56), S277 (= S298)
- binding pyridoxal-5'-phosphate: K54 (= K56), N85 (= N86), I188 (≠ Y189), G189 (= G190), T190 (= T191), G191 (= G192), G192 (= G193), T193 (= T194), G233 (= G250), S277 (= S298), P304 (= P324)
P47999 Cysteine synthase, chloroplastic/chromoplastic; At.OAS.7-4; Beta-substituted Ala synthase 2;1; ARAth-Bsas2;1; CSase B; AtCS-B; CS-B; O-acetylserine (thiol)-lyase; O-acetylserine sulfhydrylase; OAS-TL B; cpACS1; EC 2.5.1.47 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
40% identity, 91% coverage: 18:345/360 of query aligns to 77:387/392 of P47999
Sites not aligning to the query:
- 61 modified: N-acetylalanine
2efyA Crystal structure of t.Th. Hb8 o-acetylserine sulfhydrylase complexed with 4-acetylbutyric acid
39% identity, 87% coverage: 24:336/360 of query aligns to 7:301/302 of 2efyA
- active site: K40 (= K56), S70 (= S84), E200 (= E215), S204 (≠ A219), S263 (= S298)
- binding 5-oxohexanoic acid: T69 (= T83), G71 (= G85), T73 (= T87), Q141 (= Q155), G175 (= G190), G219 (= G250), M220 (≠ W251), P222 (= P253)
- binding pyridoxal-5'-phosphate: K40 (= K56), N72 (= N86), Y172 (≠ T187), G175 (= G190), T176 (= T191), G177 (= G192), T179 (= T194), G219 (= G250), S263 (= S298), P289 (= P324), D290 (= D325)
2ecqA Crystal structure of t.Th. Hb8 o-acetylserine sulfhydrylase complexed with 3-hydroxylactate
39% identity, 87% coverage: 24:336/360 of query aligns to 7:301/302 of 2ecqA
- active site: K40 (= K56), S70 (= S84), E200 (= E215), S204 (≠ A219), S263 (= S298)
- binding (3s)-3-hydroxybutanoic acid: K40 (= K56), G71 (= G85), T73 (= T87), Q141 (= Q155), G219 (= G250)
- binding pyridoxal-5'-phosphate: K40 (= K56), N72 (= N86), Y172 (≠ T187), G173 (= G188), G175 (= G190), T176 (= T191), T179 (= T194), G219 (= G250), S263 (= S298), P289 (= P324)
2ecoA Crystal structure of t.Th. Hb8 o-acetylserine sulfhydrylase complexed with 4-methylvalerate
39% identity, 87% coverage: 24:336/360 of query aligns to 7:301/302 of 2ecoA
- active site: K40 (= K56), S70 (= S84), E200 (= E215), S204 (≠ A219), S263 (= S298)
- binding 4-methyl valeric acid: K40 (= K56), T69 (= T83), G71 (= G85), T73 (= T87), Q141 (= Q155), G175 (= G190), T176 (= T191), G219 (= G250)
- binding pyridoxal-5'-phosphate: K40 (= K56), N72 (= N86), Y172 (≠ T187), G175 (= G190), T176 (= T191), T179 (= T194), G219 (= G250), S263 (= S298), P289 (= P324), D290 (= D325)
5xemA Crystal structure of a hydrogen sulfide-producing enzyme (fn1220) from fusobacterium nucleatum in complex with l-lanthionine-plp schiff base
39% identity, 88% coverage: 18:333/360 of query aligns to 4:302/302 of 5xemA
- binding (2R)-2-azanyl-3-[(2R)-2-azanyl-3-oxidanyl-3-oxidanylidene-propyl]sulfanyl-propanoic acid: K42 (= K56), T69 (= T83), S70 (= S84), N72 (= N86), T73 (= T87), M120 (≠ G134), Q142 (= Q155), G176 (= G190), T177 (= T191), G220 (= G250), M221 (≠ W251), G222 (≠ T252), S224 (≠ D254)
- binding calcium ion: L300 (= L331), S301 (= S332), N302 (≠ T333)
- binding pyridoxal-5'-phosphate: K42 (= K56), N72 (= N86), T175 (≠ Y189), G176 (= G190), T177 (= T191), G178 (= G192), S180 (≠ T194), G220 (= G250), S266 (= S298), T293 (≠ P324), D294 (= D325)
4lmbA Crystal structure analysis of o-acetylserine sulfhydrylase cysk2 complexed with cystine from microcystis aeruginosa 7806 (see paper)
40% identity, 88% coverage: 20:337/360 of query aligns to 7:309/310 of 4lmbA
- active site: K46 (= K56), S269 (= S298)
- binding cysteine: K46 (= K56), T74 (= T83), S75 (= S84), N77 (= N86), T78 (= T87), M101 (≠ F110), M125 (≠ G134), M125 (≠ G134), Q147 (= Q155), F148 (= F156), Q224 (= Q249), G225 (= G250), G225 (= G250), I226 (≠ W251), A228 (≠ P253)
- binding pyridoxal-5'-phosphate: K46 (= K56), N77 (= N86), V180 (≠ Y189), G181 (= G190), T182 (= T191), G183 (= G192), T185 (= T194), G225 (= G250), S269 (= S298), P296 (= P324)
Query Sequence
>3607478 FitnessBrowser__Dino:3607478
MTATPPIRRTTGNGKTYDSVLDTVGNTPVIRINNLAPEGVELYVKAEFFNPAASVKDRLA
LNIIEAAERAGTLKPGQTVVEATSGNTGIGLAMVCAQKGYPLVITMAESFSIERRKLMRL
LGAKVVLTPRAEKGFGMYRKAVELAEANGWFLASQFETAANAEMHENTTAQEILGDFEGC
KLDYIVTGYGTGGTVTGLGRVLRKARPETKIILTEPANAQLLGSGIAQDRDPNGAPAVSH
SAFEPHPIQGWTPDFIPKVLQESIDQGFYDALLPVAGADGIAWARRLAAEEGILTGISGG
STFAISHEVAKTAPEGSVILCMLPDTGERYLSTPLFEGIVEDMNEDERAISASTPGYQMP
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory