Comparing 3607497 FitnessBrowser__Dino:3607497 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
O59954 Adenylyltransferase and sulfurtransferase uba4; Common component for nitrate reductase and xanthine dehydrogenase protein F; Ubiquitin-like protein activator 4; EC 2.7.7.80; EC 2.8.1.11 from Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) (Aspergillus nidulans) (see paper)
43% identity, 62% coverage: 3:200/321 of query aligns to 68:278/482 of O59954
Q9VLJ8 Adenylyltransferase and sulfurtransferase MOCS3; Molybdenum cofactor synthesis protein 3; Ubiquitin activating enzyme 4; EC 2.7.7.80; EC 2.8.1.11 from Drosophila melanogaster (Fruit fly) (see paper)
35% identity, 70% coverage: 1:226/321 of query aligns to 69:299/453 of Q9VLJ8
Sites not aligning to the query:
Q72J02 Sulfur carrier protein adenylyltransferase; E1-like protein TtuC; Sulfur carrier protein MoaD adenylyltransferase; Sulfur carrier protein ThiS adenylyltransferase; Sulfur carrier protein TtuB adenylyltransferase; tRNA two-thiouridine-synthesizing protein C; EC 2.7.7.80; EC 2.7.7.73; EC 2.7.7.- from Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27) (see paper)
44% identity, 70% coverage: 1:225/321 of query aligns to 8:239/271 of Q72J02
Sites not aligning to the query:
P38820 Adenylyltransferase and sulfurtransferase UBA4; Needs CLA4 to survive protein 3; Ubiquitin-like protein activator 4; EC 2.7.7.-; EC 2.8.1.- from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see 4 papers)
37% identity, 63% coverage: 3:203/321 of query aligns to 46:253/440 of P38820
Sites not aligning to the query:
P12282 Molybdopterin-synthase adenylyltransferase; MoaD protein adenylase; Molybdopterin-converting factor subunit 1 adenylase; Sulfur carrier protein MoaD adenylyltransferase; EC 2.7.7.80 from Escherichia coli (strain K12) (see 2 papers)
37% identity, 72% coverage: 1:230/321 of query aligns to 9:242/249 of P12282
Sites not aligning to the query:
1zfnA Structural analysis of escherichia coli thif (see paper)
40% identity, 69% coverage: 3:225/321 of query aligns to 8:235/244 of 1zfnA
Sites not aligning to the query:
P30138 Sulfur carrier protein ThiS adenylyltransferase; EC 2.7.7.73 from Escherichia coli (strain K12) (see 3 papers)
40% identity, 69% coverage: 3:225/321 of query aligns to 8:235/251 of P30138
Sites not aligning to the query:
6yubB Crystal structure of uba4 from chaetomium thermophilum (see paper)
35% identity, 74% coverage: 1:238/321 of query aligns to 12:258/289 of 6yubB
Sites not aligning to the query:
6yubA Crystal structure of uba4 from chaetomium thermophilum (see paper)
38% identity, 63% coverage: 1:201/321 of query aligns to 11:214/423 of 6yubA
Sites not aligning to the query:
O95396 Adenylyltransferase and sulfurtransferase MOCS3; Molybdenum cofactor synthesis protein 3; Molybdopterin synthase sulfurylase; MPT synthase sulfurylase; EC 2.7.7.80; EC 2.8.1.11 from Homo sapiens (Human) (see 5 papers)
41% identity, 67% coverage: 1:215/321 of query aligns to 60:279/460 of O95396
Sites not aligning to the query:
D4GSF3 SAMP-activating enzyme E1; Ubiquitin-like activating enzyme of archaea; Ubl-activating enzyme; EC 2.7.7.- from Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) (Halobacterium volcanii) (see paper)
36% identity, 72% coverage: 1:231/321 of query aligns to 10:244/270 of D4GSF3
1zud3 Structure of this-thif protein complex (see paper)
39% identity, 69% coverage: 3:225/321 of query aligns to 8:230/240 of 1zud3
Sites not aligning to the query:
1jwbB Structure of the covalent acyl-adenylate form of the moeb-moad protein complex (see paper)
37% identity, 72% coverage: 1:230/321 of query aligns to 8:234/240 of 1jwbB
Sites not aligning to the query:
1jw9B Structure of the native moeb-moad protein complex (see paper)
37% identity, 72% coverage: 1:230/321 of query aligns to 8:234/240 of 1jw9B
Sites not aligning to the query:
1jwaB Structure of the atp-bound moeb-moad protein complex (see paper)
35% identity, 70% coverage: 1:226/321 of query aligns to 8:215/217 of 1jwaB
4yedD Tcda (csdl) (see paper)
30% identity, 69% coverage: 21:243/321 of query aligns to 27:255/255 of 4yedD
4d79A Crystal structure of e. Coli tRNA n6-threonylcarbamoyladenosine dehydratase, tcda, in complex with atp at 1.768 angstroem resolution (see paper)
36% identity, 41% coverage: 21:151/321 of query aligns to 26:157/243 of 4d79A
8ideA Structure of an ancient tsad-tsac-sua5-tcda modular enzyme (tsan) (see paper)
39% identity, 35% coverage: 12:123/321 of query aligns to 689:802/929 of 8ideA
Sites not aligning to the query:
O42939 Ubiquitin-activating enzyme E1-like; Pmt3-activating enzyme subunit 2 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
30% identity, 51% coverage: 11:175/321 of query aligns to 13:181/628 of O42939
Sites not aligning to the query:
Q7SXG4 SUMO-activating enzyme subunit 2; Ubiquitin-like 1-activating enzyme E1B; Ubiquitin-like modifier-activating enzyme 2; EC 2.3.2.- from Danio rerio (Zebrafish) (Brachydanio rerio) (see paper)
30% identity, 46% coverage: 21:168/321 of query aligns to 16:166/650 of Q7SXG4
Sites not aligning to the query:
>3607497 FitnessBrowser__Dino:3607497
MTRYARQVQLPQVGAEGQARLAAAHVLVIGAGGLAAPALSYLAGAGVGRITVMDADRVSL
SNLHRQTLFTMDDIGAPKAEAAAARLRAQNPEVTITALCEAFTPANGAARLAGVDLVLDC
ADSYAASYTASDLCGPVPLITASVLGASGYVAGCCGGAPSLRALFPDPPDSAASCATAGV
FGPVVGALGALQAQMALGALLGLKPSSLGQAITLDTATWRMASFRFDAAPEPDRALRFIA
ASQITETDAVYDLRPESEARHTVGQGAIRLPDTCPTQIRPAKRVVLACSSGLRAWRLGTA
LGPDFPGEIVLVADPQQETTP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory