SitesBLAST
Comparing 3607519 FitnessBrowser__Dino:3607519 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3meqA Crystal structure of alcohol dehydrogenase from brucella melitensis
67% identity, 99% coverage: 4:339/339 of query aligns to 3:340/341 of 3meqA
- active site: C40 (= C41), H41 (= H42), T42 (= T43), H45 (= H46), H63 (= H64), E64 (= E65), C94 (= C95), C97 (= C98), C100 (= C101), C108 (= C109), L112 (≠ E114), C150 (= C152), T154 (= T156), R335 (= R334)
- binding 1,4-dihydronicotinamide adenine dinucleotide: C40 (= C41), H41 (= H42), T42 (= T43), H45 (= H46), C150 (= C152), T154 (= T156), G176 (= G178), G177 (= G179), L178 (= L180), D197 (= D199), I198 (≠ V200), K202 (= K204), T241 (= T240), A242 (= A241), V243 (= V242), S244 (= S243), A247 (= A246), N264 (≠ V263), G265 (= G264), L266 (= L265), I289 (= I288), V290 (= V289)
- binding zinc ion: C40 (= C41), H63 (= H64), C94 (= C95), C97 (= C98), C100 (= C101), C108 (= C109), C150 (= C152)
1lluA The ternary complex of pseudomonas aeruginosa alcohol dehydrogenase with its coenzyme and weak substrate (see paper)
65% identity, 99% coverage: 4:339/339 of query aligns to 6:341/341 of 1lluA
- active site: C43 (= C41), H44 (= H42), T45 (= T43), H48 (= H46), H66 (= H64), E67 (= E65), C97 (= C95), C100 (= C98), C103 (= C101), C111 (= C109), Q115 (≠ E114), C153 (= C152), T157 (= T156), R336 (= R334)
- binding 1,2-ethanediol: H44 (= H42), T45 (= T43), L47 (= L45), D53 (= D51), W92 (= W90), C153 (= C152)
- binding nicotinamide-adenine-dinucleotide: C43 (= C41), H44 (= H42), T45 (= T43), H48 (= H46), C153 (= C152), T157 (= T156), G179 (= G178), G180 (= G179), L181 (= L180), D200 (= D199), I201 (≠ V200), K205 (= K204), A243 (= A241), V244 (= V242), S245 (= S243), A248 (= A246), V265 (= V263), L267 (= L265), I290 (= I288), V291 (= V289), R336 (= R334)
- binding zinc ion: C43 (= C41), H66 (= H64), C100 (= C98), C103 (= C101), C111 (= C109), C153 (= C152)
3s2fE Crystal structure of furx nadh:furfural
64% identity, 99% coverage: 2:337/339 of query aligns to 1:336/340 of 3s2fE
- active site: C40 (= C41), H41 (= H42), T42 (= T43), H45 (= H46), H63 (= H64), E64 (= E65), C94 (= C95), C97 (= C98), C100 (= C101), C108 (= C109), Q112 (≠ E114), C150 (= C152), T154 (= T156), R333 (= R334)
- binding furfural: T42 (= T43), W51 (= W52), H63 (= H64), W89 (= W90), C150 (= C152), I287 (= I288)
- binding nicotinamide-adenine-dinucleotide: C40 (= C41), H41 (= H42), T42 (= T43), C150 (= C152), T154 (= T156), G174 (= G176), G176 (= G178), G177 (= G179), L178 (= L180), D197 (= D199), I198 (≠ V200), K202 (= K204), T239 (= T240), A240 (= A241), V241 (= V242), N262 (≠ V263), G263 (= G264), L264 (= L265), I287 (= I288), V288 (= V289), R333 (= R334)
- binding zinc ion: C40 (= C41), H63 (= H64), C94 (= C95), C97 (= C98), C100 (= C101), C108 (= C109), C150 (= C152)
3s2fA Crystal structure of furx nadh:furfural
64% identity, 99% coverage: 2:337/339 of query aligns to 1:336/340 of 3s2fA
- active site: C40 (= C41), H41 (= H42), T42 (= T43), H45 (= H46), H63 (= H64), E64 (= E65), C94 (= C95), C97 (= C98), C100 (= C101), C108 (= C109), Q112 (≠ E114), C150 (= C152), T154 (= T156), R333 (= R334)
- binding phosphorylisopropane: T42 (= T43), H63 (= H64), W89 (= W90), I287 (= I288)
- binding zinc ion: C40 (= C41), H63 (= H64), E64 (= E65), C94 (= C95), C97 (= C98), C100 (= C101), C108 (= C109), C150 (= C152)
3s2eE Crystal structure of furx nadh complex 1
64% identity, 99% coverage: 2:337/339 of query aligns to 1:336/340 of 3s2eE
- active site: C40 (= C41), H41 (= H42), T42 (= T43), H45 (= H46), H63 (= H64), E64 (= E65), C94 (= C95), C97 (= C98), C100 (= C101), C108 (= C109), Q112 (≠ E114), C150 (= C152), T154 (= T156), R333 (= R334)
- binding nicotinamide-adenine-dinucleotide: C40 (= C41), H41 (= H42), T42 (= T43), C150 (= C152), T154 (= T156), G176 (= G178), G177 (= G179), L178 (= L180), D197 (= D199), I198 (≠ V200), K202 (= K204), T239 (= T240), A240 (= A241), V241 (= V242), S242 (= S243), A245 (= A246), N262 (≠ V263), G263 (= G264), L264 (= L265), I287 (= I288), V288 (= V289)
- binding zinc ion: C40 (= C41), H63 (= H64), C94 (= C95), C97 (= C98), C100 (= C101), C108 (= C109), C150 (= C152)
3s2eA Crystal structure of furx nadh complex 1
64% identity, 99% coverage: 2:337/339 of query aligns to 1:336/340 of 3s2eA
- active site: C40 (= C41), H41 (= H42), T42 (= T43), H45 (= H46), H63 (= H64), E64 (= E65), C94 (= C95), C97 (= C98), C100 (= C101), C108 (= C109), Q112 (≠ E114), C150 (= C152), T154 (= T156), R333 (= R334)
- binding zinc ion: C40 (= C41), H63 (= H64), E64 (= E65), C94 (= C95), C97 (= C98), C100 (= C101), C108 (= C109), C150 (= C152)
Q8GIX7 Alcohol dehydrogenase; ADH; EC 1.1.1.1 from Moraxella sp. (strain TAE123) (see paper)
62% identity, 99% coverage: 4:337/339 of query aligns to 1:334/338 of Q8GIX7
- C38 (= C41) binding Zn(2+)
- H61 (= H64) binding Zn(2+)
- E62 (= E65) binding Zn(2+)
- C92 (= C95) binding Zn(2+)
- C95 (= C98) binding Zn(2+)
- C98 (= C101) binding Zn(2+)
- C106 (= C109) binding Zn(2+)
- C148 (= C152) binding Zn(2+)
6z42A The low resolution structure of a zinc-dependent alcohol dehydrogenase from halomonas elongata.
64% identity, 100% coverage: 2:339/339 of query aligns to 2:335/336 of 6z42A
- active site: C41 (= C41), T43 (= T43), H46 (= H46), H64 (= H64), C148 (= C152)
- binding zinc ion: C41 (= C41), H64 (= H64), E65 (= E65), C95 (= C95), C98 (= C98), C101 (= C101), C109 (= C109), C148 (= C152)
4z6kA Alcohol dehydrogenase from the antarctic psychrophile moraxella sp. Tae 123
62% identity, 99% coverage: 4:337/339 of query aligns to 1:334/345 of 4z6kA
- active site: C38 (= C41), H39 (= H42), T40 (= T43), H43 (= H46), H61 (= H64), E62 (= E65), C92 (= C95), C95 (= C98), C98 (= C101), C106 (= C109), Q110 (≠ E114), C148 (= C152), T152 (= T156), R331 (= R334)
- binding zinc ion: C38 (= C41), H61 (= H64), C92 (= C95), C95 (= C98), C98 (= C101), C106 (= C109), C148 (= C152)
6n7lC Crystal structure of an alcohol dehydrogenase from elizabethkingia anophelis nuhp1
58% identity, 99% coverage: 4:339/339 of query aligns to 8:342/344 of 6n7lC
- active site: C45 (= C41), T47 (= T43), H50 (= H46), H68 (= H64), C154 (= C152)
- binding nicotinamide-adenine-dinucleotide: C45 (= C41), H46 (= H42), T47 (= T43), H50 (= H46), C154 (= C152), T158 (= T156), G178 (= G176), G180 (= G178), G181 (= G179), L182 (= L180), D201 (= D199), V202 (= V200), K206 (= K204), T243 (= T240), A244 (= A241), V245 (= V242), S246 (= S243), A249 (= A246), N266 (≠ V263), G267 (= G264), L268 (= L265), I291 (= I288), V292 (= V289)
- binding zinc ion: C45 (= C41), H68 (= H64), C98 (= C95), C101 (= C98), C104 (= C101), C112 (= C109), C154 (= C152)
6iqdA Crystal structure of alcohol dehydrogenase from geobacillus stearothermophilus (see paper)
55% identity, 99% coverage: 4:339/339 of query aligns to 1:336/336 of 6iqdA
- active site: C38 (= C41), T40 (= T43), H43 (= H46), H61 (= H64), C148 (= C152)
- binding zinc ion: C38 (= C41), H61 (= H64), E62 (= E65), C92 (= C95), C95 (= C98), C98 (= C101), C106 (= C109), C148 (= C152)
1rjwA Crystal structure of NAD(+)-dependent alcohol dehydrogenase from bacillus stearothermophilus strain lld-r (see paper)
56% identity, 99% coverage: 4:339/339 of query aligns to 1:336/339 of 1rjwA
- active site: C38 (= C41), H39 (= H42), T40 (= T43), H43 (= H46), H61 (= H64), E62 (= E65), C92 (= C95), C95 (= C98), C98 (= C101), C106 (= C109), K110 (≠ E114), C148 (= C152), T152 (= T156), R331 (= R334)
- binding trifluoroethanol: T40 (= T43), C148 (= C152), I285 (= I288)
- binding zinc ion: C38 (= C41), H61 (= H64), C92 (= C95), C95 (= C98), C98 (= C101), C106 (= C109)
P12311 Alcohol dehydrogenase; ADH-T; EC 1.1.1.1 from Geobacillus stearothermophilus (Bacillus stearothermophilus) (see paper)
55% identity, 99% coverage: 4:339/339 of query aligns to 1:336/337 of P12311
- C38 (= C41) mutation to S: No activity.
- T40 (= T43) mutation to A: No activity.; mutation to S: Little decrease in activity.
- H43 (= H46) mutation to A: No activity.; mutation to R: Higher level of activity at pH 9.
3piiA Crystal structure of mutant of ht- alcohol dehydrogenase with substrate analogue butyramide
55% identity, 99% coverage: 4:339/339 of query aligns to 1:336/337 of 3piiA
- active site: C38 (= C41), H39 (= H42), T40 (= T43), H43 (= H46), H61 (= H64), E62 (= E65), C92 (= C95), C95 (= C98), C98 (= C101), C106 (= C109), K110 (≠ E114), C148 (= C152), T152 (= T156), R331 (= R334)
- binding butyramide: T40 (= T43), H61 (= H64), W87 (= W90), C148 (= C152)
- binding zinc ion: C38 (= C41), H61 (= H64), E62 (= E65), C92 (= C95), C95 (= C98), C98 (= C101), C106 (= C109), C148 (= C152)
4eezB Crystal structure of lactococcus lactis alcohol dehydrogenase variant re1 (see paper)
46% identity, 99% coverage: 4:337/339 of query aligns to 1:336/342 of 4eezB
- active site: C39 (= C41), H40 (= H42), T41 (= T43), H44 (= H46), H60 (= H64), E61 (= E65), C91 (= C95), C94 (= C98), C97 (= C101), C105 (= C109), K109 (≠ E114), C147 (= C152), T151 (= T156), R333 (= R334)
- binding zinc ion: C39 (= C41), H60 (= H64), E61 (= E65), C91 (= C95), C94 (= C98), C97 (= C101), C105 (= C109), C147 (= C152)
4gkvB Structure of escherichia coli adhp (ethanol-inducible dehydrogenase) with bound NAD (see paper)
47% identity, 99% coverage: 4:337/339 of query aligns to 1:332/336 of 4gkvB
- active site: C37 (= C41), H38 (= H42), T39 (= T43), H42 (= H46), H58 (= H64), E59 (= E65), C89 (= C95), C92 (= C98), C95 (= C101), C103 (= C109), K107 (≠ E114), C145 (= C152), T149 (= T156), R329 (= R334)
- binding nicotinamide-adenine-dinucleotide: C37 (= C41), H38 (= H42), T39 (= T43), H42 (= H46), C145 (= C152), T149 (= T156), G169 (= G176), G171 (= G178), G172 (= G179), L173 (= L180), D193 (= D199), V194 (= V200), Q198 (≠ K204), T235 (= T240), A236 (= A241), V237 (= V242), V258 (= V263), G259 (= G264), L260 (= L265), L283 (≠ I288), V284 (= V289), R329 (= R334)
- binding zinc ion: C37 (= C41), H58 (= H64), C89 (= C95), C92 (= C98), C95 (= C101), C103 (= C109), C145 (= C152)
- binding : Q223 (≠ A229), D247 (≠ G252), R271 (≠ D276), L274 (= L279)
P00330 Alcohol dehydrogenase 1; Alcohol dehydrogenase I; ADHI; NADH-dependent methylglyoxal reductase; YADH-1; EC 1.1.1.1; EC 1.1.1.54; EC 1.1.1.78 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see 6 papers)
41% identity, 99% coverage: 4:337/339 of query aligns to 7:344/348 of P00330
- C44 (= C41) binding Zn(2+)
- H45 (= H42) binding NAD(+); mutation to R: Decreases dissociation constants by 4-fold for NAD(+) and 2-fold for NADH, while turnover numbers were decreased by 4-fold for ethanol oxidation and 6-fold for acetaldehyde reduction.
- T46 (= T43) binding NAD(+); mutation to S: Has the same pattern of activity as the wild-type enzyme for linear primary alcohols.
- H49 (= H46) binding NAD(+)
- W55 (= W52) mutation to M: Has lowered reactivity with primary and secondary alcohols.
- H67 (= H64) binding Zn(2+)
- E68 (= E65) binding in the open conformation
- W93 (= W90) mutation to A: Has an inverted specificity pattern for primary alcohols, being 3- and 10-fold more active on hexanol and 350- and 540-fold less active on ethanol. Also acquires weak activity on branched chain alcohols and cyclohexanol.
- C98 (= C95) binding Zn(2+)
- C101 (= C98) binding Zn(2+)
- C104 (= C101) binding Zn(2+)
- C112 (= C109) binding Zn(2+)
- C154 (= C152) binding Zn(2+)
- G181 (= G178) binding NAD(+)
- G182 (= G179) binding NAD(+)
- L183 (= L180) binding NAD(+)
- D202 (= D199) binding NAD(+)
- K207 (= K204) binding NAD(+)
- F222 (vs. gap) binding NAD(+)
- T236 (vs. gap) natural variant: T -> I
- V269 (= V263) binding NAD(+)
- M271 (≠ L265) binding NAD(+); mutation to L: Produces a 7 to 10-fold increase in reactivity with butanol, pentanol, and hexanol.
- S294 (= S287) binding NAD(+)
- V296 (= V289) binding NAD(+)
- R341 (= R334) binding NAD(+)
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylserine
5envA Yeast alcohol dehydrogenase with bound coenzyme (see paper)
41% identity, 99% coverage: 4:337/339 of query aligns to 6:343/347 of 5envA
- active site: C43 (= C41), H44 (= H42), T45 (= T43), H48 (= H46), H66 (= H64), E67 (= E65), C97 (= C95), C100 (= C98), C103 (= C101), C111 (= C109), D115 (≠ E114), C153 (= C152), R340 (= R334)
- binding trifluoroethanol: T45 (= T43), W54 (= W52), H66 (= H64), W92 (= W90), C153 (= C152), M270 (≠ L265), Y294 (≠ I288)
- binding nicotinamide-adenine-dinucleotide: H44 (= H42), T45 (= T43), H48 (= H46), T157 (= T156), G177 (= G176), G180 (= G178), G181 (= G179), L182 (= L180), D201 (= D199), K206 (= K204), F221 (vs. gap), S246 (≠ A241), V268 (= V263), G269 (= G264), V295 (= V289)
- binding zinc ion: C43 (= C41), H66 (= H64), C97 (= C95), C100 (= C98), C103 (= C101), C111 (= C109), C153 (= C152)
4w6zA Yeast alcohol dehydrogenase i, saccharomyces cerevisiae fermentative enzyme (see paper)
41% identity, 99% coverage: 4:337/339 of query aligns to 6:343/347 of 4w6zA
- active site: C43 (= C41), H44 (= H42), T45 (= T43), H48 (= H46), H66 (= H64), E67 (= E65), C97 (= C95), C100 (= C98), C103 (= C101), C111 (= C109), D115 (≠ E114), C153 (= C152), R340 (= R334)
- binding nicotinamide-8-iodo-adenine-dinucleotide: C43 (= C41), H44 (= H42), T45 (= T43), H48 (= H46), W54 (= W52), C153 (= C152), T157 (= T156), G177 (= G176), G180 (= G178), G181 (= G179), L182 (= L180), I200 (≠ V198), D201 (= D199), K206 (= K204), F221 (vs. gap), S246 (≠ A241), S248 (= S243), A251 (= A246), V268 (= V263), G269 (= G264), M270 (≠ L265), S293 (= S287), Y294 (≠ I288), V295 (= V289), R340 (= R334)
- binding trifluoroethanol: T45 (= T43), W54 (= W52), H66 (= H64), W92 (= W90), C153 (= C152)
- binding zinc ion: C43 (= C41), H66 (= H64), C97 (= C95), C100 (= C98), C103 (= C101), C111 (= C109), C153 (= C152)
P00331 Alcohol dehydrogenase 2; Alcohol dehydrogenase II; ADHII; YADH-2; EC 1.1.1.1 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
41% identity, 99% coverage: 4:337/339 of query aligns to 7:344/348 of P00331
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylserine
Query Sequence
>3607519 FitnessBrowser__Dino:3607519
MSMMKAALVTDFSKPLEIREVRKPTVTDGNILVKIEACGVCHTDLHAARGDWPVKPEPPF
IPGHEGVGVVVEVGHNVTSVKEGDRVGVPWLHHACGHCTACVTGWETLCRTEPEYTGYTV
NGGFAEYVEADPTYVGHLPDKLDFAPAAPILCAGVTVYKGLKECDLHPGQTVVISGIGGL
GHLAVQYARAMGLHVIAVDVAEDKLALARDLGAGVAINAATQDPVAEVARLGGAEGVLVT
AVSNTAFSQGVGMLAPGGTMSLVGLPPGDFPLNIFDVVLNRKTIRGSIVGTRADLAESLS
FAAEGKVASHYATDSLDNINGIFDQMEQGRIEGRIVMTM
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory