Comparing 3607546 FitnessBrowser__Dino:3607546 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4pakA Crystal structure of a trap periplasmic solute binding protein from verminephrobacter eiseniae ef01-2 (veis_3954, target efi-510324) a nephridial symbiont of the earthworm eisenia foetida, bound to (r)- pantoic acid (see paper)
34% identity, 86% coverage: 22:301/326 of query aligns to 2:284/304 of 4pakA
4p9kA Crystal structure of a trap periplasmic solute binding protein from verminephrobacter eiseniae ef01-2 (veis_3954, target efi-510324) a nephridial symbiont of the earthworm eisenia foetida, bound to d- erythronate with residual density suggestive of superposition with copurified alternative ligand. (see paper)
34% identity, 86% coverage: 22:301/326 of query aligns to 1:283/303 of 4p9kA
4pdhA Crystal structure of a trap periplasmic solute binding protein from polaromonas sp js666 (bpro_1871, target efi-510164) bound to d- erythronate (see paper)
33% identity, 85% coverage: 24:301/326 of query aligns to 1:281/301 of 4pdhA
4nq8B Crystal structure of a trap periplasmic solute binding protein from bordetella bronchispeptica (bb3421), target efi-510039, with density modeled as pantoate (see paper)
37% identity, 79% coverage: 46:302/326 of query aligns to 23:281/301 of 4nq8B
Sites not aligning to the query:
7bcrA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with galactonate (see paper)
32% identity, 70% coverage: 56:282/326 of query aligns to 36:263/310 of 7bcrA
Sites not aligning to the query:
7bcpA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with gluconate (see paper)
32% identity, 70% coverage: 56:282/326 of query aligns to 36:263/310 of 7bcpA
Sites not aligning to the query:
7bcoA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with d-foconate (see paper)
32% identity, 70% coverage: 56:282/326 of query aligns to 36:263/310 of 7bcoA
Sites not aligning to the query:
7bcnA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t in complex with xylonic acid (see paper)
32% identity, 70% coverage: 56:282/326 of query aligns to 36:263/310 of 7bcnA
7bbrA Crystal structure of the sugar acid binding protein dctpam from advenella mimigardefordensis strain dpn7t (see paper)
32% identity, 70% coverage: 56:282/326 of query aligns to 37:264/310 of 7bbrA
Sites not aligning to the query:
4xeqB Crystal structure of a trap periplasmic solute binding protein from desulfovibrio vulgaris (deval_0042, target efi-510114) bound to copurified (r)-pantoic acid
32% identity, 87% coverage: 36:320/326 of query aligns to 13:303/304 of 4xeqB
4pddA Crystal structure of a trap periplasmic solute binding protein from polaromonas sp js666 (bpro_0088, target efi-510167) bound to d- erythronate (see paper)
29% identity, 90% coverage: 24:318/326 of query aligns to 1:296/303 of 4pddA
4pf8A Crystal structure of a trap periplasmic solute binding protein from sulfitobacter sp. Nas-14.1 (target efi-510299) with bound beta-d- galacturonate (see paper)
32% identity, 79% coverage: 56:311/326 of query aligns to 31:294/300 of 4pf8A
Sites not aligning to the query:
4x8rA Crystal structure of a trap periplasmic solute binding protein from rhodobacter sphaeroides (rsph17029_2138, target efi-510205) with bound glucuronate
32% identity, 79% coverage: 48:304/326 of query aligns to 27:286/304 of 4x8rA
Sites not aligning to the query:
4oanA Crystal structure of a trap periplasmic solute binding protein from rhodopseudomonas palustris haa2 (rpb_2686), target efi-510221, with density modeled as (s)-2-hydroxy-2-methyl-3-oxobutanoate ((s)-2- acetolactate) (see paper)
35% identity, 72% coverage: 21:254/326 of query aligns to 3:238/312 of 4oanA
4ovqA Crystal structure of a trap periplasmic solute binding protein from roseobacter denitrificans, target efi-510230, with bound beta-d- glucuronate (see paper)
31% identity, 81% coverage: 41:304/326 of query aligns to 17:283/302 of 4ovqA
Sites not aligning to the query:
4p3lA Crystal structure of a trap periplasmic solute binding protein from chromohalobacter salexigens dsm 3043 (csal_2479), target efi-510085, with bound glucuronate, spg p6122 (see paper)
27% identity, 83% coverage: 32:303/326 of query aligns to 12:282/303 of 4p3lA
Sites not aligning to the query:
4pbqA Crystal structure of a trap periplasmic solute binding protein from haemophilus influenzae rdaw (hicg_00826, target efi-510123) with bound l-gulonate (see paper)
30% identity, 65% coverage: 39:249/326 of query aligns to 16:226/304 of 4pbqA
Sites not aligning to the query:
4ovrA Crystal structure of a trap periplasmic solute binding protein from xanthobacter autotrophicus py2, target efi-510329, with bound beta-d- galacturonate (see paper)
33% identity, 86% coverage: 43:322/326 of query aligns to 19:298/298 of 4ovrA
Sites not aligning to the query:
4xfeA Crystal structure of a trap periplasmic solute binding protein from pseudomonas putida f1 (pput_1203), target efi-500184, with bound d- glucuronate
31% identity, 83% coverage: 34:304/326 of query aligns to 10:276/306 of 4xfeA
Sites not aligning to the query:
4n8yA Crystal structure of a trap periplasmic solute binding protein from bradyrhizobium sp. Btai1 b (bbta_0128), target efi-510056 (bbta_0128), complex with alpha/beta-d-galacturonate (see paper)
29% identity, 78% coverage: 48:302/326 of query aligns to 24:281/300 of 4n8yA
Sites not aligning to the query:
>3607546 FitnessBrowser__Dino:3607546
MTTSRLALIAAASAMLMPAAAAAEAVMQINSSLPEGSFAHVFLQEYEQRLEAAAPGEIDV
QIFMSNTLGKEEDVLQGLGFGTHQASLSASAVAQVNNRTSIFDLPYLFEDRAAVQTFIDS
PAGEMLADGFDVTGMVLAAMWDNGFRQITNNVRPIVTPADLDGLKIRTPTNRQRVEMFNT
LGANATPLSFGEVYSALDQGTIDGQENPANVVETAKLFEVQGYMSLTNHVYLPTFFVIGE
PFLNSLTPELRETVISVAKEVGPWSFEWGEKSDTETIAALQEKLEVNEIDFAAFQSAAAP
LYDSPTFVDVIGADMIAATKTALGIE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory