Comparing 3607555 FitnessBrowser__Dino:3607555 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8gstC Crystal structure of l-2,4-diketo-3-deoxyrhamnonate hydrolase from sphingomonas sp. (Pyruvate bound-form) (see paper)
37% identity, 91% coverage: 9:276/294 of query aligns to 16:273/290 of 8gstC
8gsrA Crystal structure of l-2,4-diketo-3-deoxyrhamnonate hydrolase from sphingomonas sp. (Apo-form) (see paper)
37% identity, 91% coverage: 9:276/294 of query aligns to 16:273/290 of 8gsrA
6iymA Fumarylacetoacetate hydrolase (eafah) from psychrophilic exiguobacterium antarcticum (see paper)
41% identity, 74% coverage: 64:281/294 of query aligns to 62:274/277 of 6iymA
8skyB Crystal structure of yisk from bacillus subtilis in complex with oxalate (see paper)
38% identity, 72% coverage: 69:281/294 of query aligns to 86:300/303 of 8skyB
8sutA Crystal structure of yisk from bacillus subtilis in complex with reaction product 4-hydroxy-2-oxoglutaric acid (see paper)
38% identity, 72% coverage: 69:281/294 of query aligns to 87:301/303 of 8sutA
6j5xB Crystal structure of fumarylpyruvate hydrolase from corynebacterium glutamicum in complex with mn2+ and pyruvate (see paper)
32% identity, 85% coverage: 35:284/294 of query aligns to 34:279/280 of 6j5xB
6j5xA Crystal structure of fumarylpyruvate hydrolase from corynebacterium glutamicum in complex with mn2+ and pyruvate (see paper)
32% identity, 85% coverage: 35:284/294 of query aligns to 34:279/280 of 6j5xA
6v77B Crystal structure of a putative hpce protein from mycobacterium smegmatis
34% identity, 77% coverage: 57:282/294 of query aligns to 55:276/279 of 6v77B
Q6P587 Acylpyruvase FAHD1, mitochondrial; Fumarylacetoacetate hydrolase domain-containing protein 1; FAH domain-containing protein 1; Oxaloacetate decarboxylase; OAA decarboxylase; YisK-like protein; EC 3.7.1.5; EC 4.1.1.112 from Homo sapiens (Human) (see 3 papers)
35% identity, 62% coverage: 75:255/294 of query aligns to 19:201/224 of Q6P587
6fogA X-ray structure of homo sapiens fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) in complex with inhibitor oxalate at 1.94a resolution. (see paper)
35% identity, 62% coverage: 75:255/294 of query aligns to 14:196/218 of 6fogA
Sites not aligning to the query:
6sbiA X-ray structure of murine fumarylacetoacetate hydrolase domain containing protein 1 (fahd1) in complex with inhibitor oxalate (see paper)
34% identity, 62% coverage: 75:255/294 of query aligns to 13:195/216 of 6sbiA
3qdfA Crystal structure of 2-hydroxyhepta-2,4-diene-1,7-dioate isomerase from mycobacterium marinum (see paper)
32% identity, 76% coverage: 61:282/294 of query aligns to 50:248/252 of 3qdfA
3r6oA Crystal structure of a probable 2-hydroxyhepta-2,4-diene-1, 7- dioateisomerase from mycobacterium abscessus (see paper)
33% identity, 73% coverage: 69:284/294 of query aligns to 58:263/265 of 3r6oA
1gttA Crystal structure of hpce (see paper)
32% identity, 63% coverage: 66:251/294 of query aligns to 216:392/421 of 1gttA
6j5yA Crystal structure of fumarylpyruvate hydrolase from pseudomonas aeruginosa in complex with mn2+ and pyruvate (see paper)
32% identity, 71% coverage: 76:284/294 of query aligns to 26:233/233 of 6j5yA
4dbhA Crystal structure of cg1458 with inhibitor (see paper)
30% identity, 72% coverage: 73:283/294 of query aligns to 61:268/269 of 4dbhA
3v77A Crystal structure of a putative fumarylacetoacetate isomerase/hydrolase from oleispira antarctica (see paper)
29% identity, 61% coverage: 74:251/294 of query aligns to 16:197/224 of 3v77A
6jvwB Crystal structure of maleylpyruvate hydrolase from sphingobium sp. Syk-6 in complex with manganese (ii) ion and pyruvate (see paper)
28% identity, 76% coverage: 61:282/294 of query aligns to 64:261/264 of 6jvwB
1nkqA Crystal structure of yeast ynq8, a fumarylacetoacetate hydrolase family protein
25% identity, 67% coverage: 76:271/294 of query aligns to 11:222/247 of 1nkqA
1hyoB Crystal structure of fumarylacetoacetate hydrolase complexed with 4- (hydroxymethylphosphinoyl)-3-oxo-butanoic acid (see paper)
31% identity, 49% coverage: 106:249/294 of query aligns to 166:355/419 of 1hyoB
Sites not aligning to the query:
>3607555 FitnessBrowser__Dino:3607555
MRFLVGHVQGQPGVFAIVEEAATNLTALMPEIGTDLMALTRDPELVTKAAGLVGQGPQTQ
VADITPALPIAHPGTIICLGLNYVEHIREGGYEIPGYPALFMRGRNSIMPSGAPMVRPAC
SETLDYEAELMLIVGEGGRHIPEDAALEHVFGYTTFNDGSVREYQRKTHQWTPGKNFDAT
GAVGPIVVTPDELPEGAKGLKIESRVGNEILQSSNTENMIWGAAKTLSIISEYTTLEPGD
LIALGTPPGVGHAKKPGPRWLRPGEVIEVEIEGIGTCANPVVDETAMAARKAAE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory