Comparing 3607562 FitnessBrowser__Dino:3607562 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4ryaA Crystal structure of abc transporter solute binding protein avi_3567 from agrobacterium vitis s4, target efi-510645, with bound d-mannitol
68% identity, 95% coverage: 23:434/435 of query aligns to 1:415/417 of 4ryaA
1eu8A Structure of trehalose maltose binding protein from thermococcus litoralis (see paper)
27% identity, 88% coverage: 40:422/435 of query aligns to 21:398/407 of 1eu8A
Sites not aligning to the query:
Q7LYW7 Trehalose/maltose-binding protein MalE; TMBP from Thermococcus litoralis (strain ATCC 51850 / DSM 5473 / JCM 8560 / NS-C) (see paper)
27% identity, 88% coverage: 40:422/435 of query aligns to 62:439/450 of Q7LYW7
Sites not aligning to the query:
5iaiA Crystal structure of abc transporter solute binding protein arad_9887 from agrobacterium radiobacter k84, target efi-510945 in complex with ribitol
26% identity, 69% coverage: 26:324/435 of query aligns to 8:309/399 of 5iaiA
Sites not aligning to the query:
6dtqA Maltose bound t. Maritima male3 (see paper)
29% identity, 63% coverage: 101:372/435 of query aligns to 78:348/391 of 6dtqA
Sites not aligning to the query:
5ci5A Crystal structure of an abc transporter solute binding protein from thermotoga lettingae tmo (tlet_1705, target efi-510544) bound with alpha-d-tagatose
23% identity, 90% coverage: 42:431/435 of query aligns to 22:393/393 of 5ci5A
Sites not aligning to the query:
7qhvAAA Sulfoquinovosyl binding protein (see paper)
24% identity, 62% coverage: 66:334/435 of query aligns to 47:307/390 of 7qhvAAA
Sites not aligning to the query:
7yzsAAA Sulfoquinovosyl binding protein (see paper)
23% identity, 62% coverage: 66:334/435 of query aligns to 46:307/384 of 7yzsAAA
Sites not aligning to the query:
7ofyA Crystal structure of sq binding protein from agrobacterium tumefaciens in complex with sulfoquinovosyl glycerol (sqgro) (see paper)
23% identity, 62% coverage: 66:334/435 of query aligns to 48:309/389 of 7ofyA
Sites not aligning to the query:
A9CEY9 Sulfoquinovosyl glycerol-binding protein SmoF; SQGro-binding protein SmoF; SQ monooxygenase cluster protein F from Agrobacterium fabrum (strain C58 / ATCC 33970) (Agrobacterium tumefaciens (strain C58)) (see 2 papers)
23% identity, 62% coverage: 66:334/435 of query aligns to 76:337/416 of A9CEY9
Sites not aligning to the query:
7yzuA Crystal structure of the sulfoquinovosyl binding protein smof complexed with sqme (see paper)
25% identity, 62% coverage: 66:334/435 of query aligns to 45:304/382 of 7yzuA
Sites not aligning to the query:
3k02A Crystal structures of the gach receptor of streptomyces glaucescens gla.O in the unliganded form and in complex with acarbose and an acarbose homolog. Comparison with acarbose-loaded maltose binding protein of salmonella typhimurium. (see paper)
23% identity, 78% coverage: 30:368/435 of query aligns to 11:340/388 of 3k02A
Sites not aligning to the query:
3jzjA Crystal structures of the gach receptor of streptomyces glaucescens gla.O in the unliganded form and in complex with acarbose and an acarbose homolog. Comparison with acarbose-loaded maltose binding protein of salmonella typhimurium. (see paper)
23% identity, 78% coverage: 30:368/435 of query aligns to 11:340/388 of 3jzjA
Sites not aligning to the query:
5ysdB Crystal structure of beta-1,2-glucooligosaccharide binding protein in complex with sophorotriose (see paper)
24% identity, 90% coverage: 39:431/435 of query aligns to 16:377/389 of 5ysdB
Sites not aligning to the query:
5ysbA Crystal structure of beta-1,2-glucooligosaccharide binding protein in ligand-free form (see paper)
24% identity, 90% coverage: 39:431/435 of query aligns to 15:376/386 of 5ysbA
Sites not aligning to the query:
5ysdA Crystal structure of beta-1,2-glucooligosaccharide binding protein in complex with sophorotriose (see paper)
24% identity, 90% coverage: 39:431/435 of query aligns to 16:377/387 of 5ysdA
Sites not aligning to the query:
8artB Abc transporter binding protein male from streptomyces scabiei in complex with maltose
25% identity, 85% coverage: 54:422/435 of query aligns to 37:381/393 of 8artB
Sites not aligning to the query:
1eljA The crystal structure of liganded maltodextrin-binding protein from pyrococcus furiosus (see paper)
25% identity, 56% coverage: 96:340/435 of query aligns to 77:306/380 of 1eljA
Sites not aligning to the query:
4g68A Biochemical and structural insights into xylan utilization by the thermophilic bacteriumcaldanaerobius polysaccharolyticus (see paper)
24% identity, 55% coverage: 52:290/435 of query aligns to 33:269/392 of 4g68A
Sites not aligning to the query:
7v09A Crystal structure of ecl_rs08780, putative sugar transport system periplasmic sugar-binding protein
26% identity, 54% coverage: 111:344/435 of query aligns to 98:312/403 of 7v09A
Sites not aligning to the query:
>3607562 FitnessBrowser__Dino:3607562
MSLKNALYAATALTLVSSGAMASENLVIATVNNGDMIRMQGLTQDFTDKTGHTVEWVTLE
ENVLRQRVTTDIAAKGGSFDIMTIGMYETPIWGANGWLVPLDDLSADYNADDILPAMRAG
LSHDGTLYAAPFYGESSMIMYRKDLMEKAGLEMPDAPTWQFIREAAAAMTDRENDINGIC
LRGKAGWGEGGAFITVTANSFGARWFDEDWNAQFDQPEWKEALEFFVGMMNESGPNGYAT
NGFNENLNLFQQGKCGMWIDATVAASFVTNPNDSTVADQVGFALAPNSEGIEKRANWLWA
WALAIPAGTQKADAAKEFIEWATSTDYIELVAANEGWANVPPGARTSLYENENYKDIPFA
KMTLDSILAADPTDPTVDPVPYVGIQFVAIPEFAGIATEVSQEFSAVYAGQQTVEEALEK
AQALTNDAMEAAGYR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory