SitesBLAST
Comparing 3607592 FitnessBrowser__Dino:3607592 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3dc2A Crystal structure of serine bound d-3-phosphoglycerate dehydrogenase from mycobacterium tuberculosis (see paper)
36% identity, 96% coverage: 5:308/316 of query aligns to 4:301/526 of 3dc2A
Sites not aligning to the query:
3ddnB Crystal structure of hydroxypyruvic acid phosphate bound d-3- phosphoglycerate dehydrogenase in mycobacterium tuberculosis (see paper)
36% identity, 96% coverage: 5:308/316 of query aligns to 5:302/525 of 3ddnB
1wwkA Crystal structure of phosphoglycerate dehydrogenase from pyrococcus horikoshii ot3
38% identity, 86% coverage: 23:295/316 of query aligns to 22:289/304 of 1wwkA
- active site: S96 (≠ N99), R230 (≠ H234), D254 (= D258), E259 (= E263), H278 (= H284)
- binding nicotinamide-adenine-dinucleotide: V100 (= V103), G146 (= G150), F147 (≠ C151), G148 (= G152), R149 (≠ A153), I150 (≠ V154), Y168 (≠ H172), D169 (= D173), P170 (= P174), V201 (≠ L205), P202 (= P206), T207 (= T211), T228 (= T232), S229 (≠ A233), D254 (= D258), H278 (= H284), G280 (≠ A286)
P87228 Putative D-3-phosphoglycerate dehydrogenase; 3-PGDH; 2-oxoglutarate reductase; EC 1.1.1.95; EC 1.1.1.399 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
34% identity, 93% coverage: 4:296/316 of query aligns to 57:356/466 of P87228
- S87 (≠ A37) modified: Phosphoserine
- S258 (≠ T208) modified: Phosphoserine
P0A9T0 D-3-phosphoglycerate dehydrogenase; PGDH; 2-oxoglutarate reductase; EC 1.1.1.95; EC 1.1.1.399 from Escherichia coli (strain K12) (see 2 papers)
38% identity, 78% coverage: 50:296/316 of query aligns to 59:304/410 of P0A9T0
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
1psdA The allosteric ligand site in the vmax-type cooperative enzyme phosphoglycerate dehydrogenase (see paper)
38% identity, 78% coverage: 50:296/316 of query aligns to 53:298/404 of 1psdA
- active site: N102 (= N99), R234 (≠ H234), D258 (= D258), E263 (= E263), H286 (= H284)
- binding nicotinamide-adenine-dinucleotide: N102 (= N99), H155 (≠ A153), I156 (≠ V154), D175 (= D173), I176 (≠ L176), K179 (≠ G179), H204 (= H204), V205 (≠ L205), P206 (= P206), A232 (≠ T232), S233 (≠ A233), R234 (≠ H234), H286 (= H284)
Sites not aligning to the query:
1ybaA The active form of phosphoglycerate dehydrogenase (see paper)
38% identity, 78% coverage: 50:296/316 of query aligns to 55:300/406 of 1ybaA
- active site: N104 (= N99), R236 (≠ H234), D260 (= D258), E265 (= E263), H288 (= H284)
- binding 2-oxoglutaric acid: R56 (= R51), S57 (≠ N52), C79 (≠ G74), I80 (≠ T75)
- binding nicotinamide-adenine-dinucleotide: I80 (≠ T75), F102 (≠ G97), V108 (= V103), G154 (= G150), G156 (= G152), H157 (≠ A153), I158 (≠ V154), Y176 (≠ H172), D177 (= D173), I178 (≠ L176), K181 (≠ G179), H206 (= H204), V207 (≠ L205), P208 (= P206), A234 (≠ T232), S235 (≠ A233), R236 (≠ H234), H288 (= H284), G290 (≠ A286)
- binding phosphate ion: G81 (= G76), N83 (≠ D78)
2p9eA Crystal structure of g336v mutant of e.Coli phosphoglycerate dehydrogenase (see paper)
38% identity, 78% coverage: 50:296/316 of query aligns to 55:300/406 of 2p9eA
- active site: N104 (= N99), R236 (≠ H234), D260 (= D258), E265 (= E263), H288 (= H284)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G156 (= G152), H157 (≠ A153), I158 (≠ V154), Y176 (≠ H172), D177 (= D173), I178 (≠ L176), H206 (= H204), V207 (≠ L205), P208 (= P206), S212 (≠ E210), A234 (≠ T232), S235 (≠ A233), R236 (≠ H234), H288 (= H284), G290 (≠ A286)
6rj2A Crystal structure of phgdh in complex with compound 40 (see paper)
34% identity, 80% coverage: 45:296/316 of query aligns to 40:287/299 of 6rj2A
- binding ~{N}-[(1~{R})-1-[4-(ethanoylsulfamoyl)phenyl]ethyl]-2-methyl-5-phenyl-pyrazole-3-carboxamide: G146 (= G152), I148 (≠ V154), Y166 (≠ H172), D167 (= D173), P168 (= P174), I169 (≠ H175), I170 (≠ L176), H198 (= H204), T199 (≠ L205), L208 (≠ R214), R228 (≠ H234)
6plgA Crystal structure of human phgdh complexed with compound 15 (see paper)
34% identity, 80% coverage: 45:296/316 of query aligns to 43:290/303 of 6plgA
6cwaA Crystal structure phgdh in complex with nadh and 3-phosphoglycerate at 1.77 a resolution (see paper)
34% identity, 80% coverage: 45:296/316 of query aligns to 42:289/299 of 6cwaA
- binding 1,4-dihydronicotinamide adenine dinucleotide: N96 (= N99), A100 (≠ V103), R149 (≠ A153), I150 (≠ V154), Y168 (≠ H172), D169 (= D173), P170 (= P174), I171 (≠ H175), H200 (= H204), T201 (≠ L205), P202 (= P206), T207 (= T211), C228 (≠ T232), A229 (= A233), R230 (≠ H234), H277 (= H284), G279 (≠ A286)
7ewhA Crystal structure of human phgdh in complex with homoharringtonine (see paper)
34% identity, 80% coverage: 45:296/316 of query aligns to 43:290/302 of 7ewhA
- binding (3beta)-O~3~-[(2R)-2,6-dihydroxy-2-(2-methoxy-2-oxoethyl)-6-methylheptanoyl]cephalotaxine: L146 (≠ Y149), G147 (= G150), L148 (≠ C151), G149 (= G152), R150 (≠ A153), I151 (≠ V154), G152 (≠ A155), D170 (= D173), H201 (= H204), T202 (≠ L205), P203 (= P206)
6rihA Crystal structure of phgdh in complex with compound 9 (see paper)
34% identity, 80% coverage: 45:296/316 of query aligns to 43:290/302 of 6rihA
6rj5A Crystal structure of phgdh in complex with compound 39 (see paper)
34% identity, 80% coverage: 45:296/316 of query aligns to 43:290/301 of 6rj5A
6plfA Crystal structure of human phgdh complexed with compound 1 (see paper)
34% identity, 80% coverage: 45:296/316 of query aligns to 44:291/305 of 6plfA
7dkmA Phgdh covalently linked to oridonin (see paper)
34% identity, 80% coverage: 45:296/316 of query aligns to 44:291/306 of 7dkmA
- binding nicotinamide-adenine-dinucleotide: T74 (= T75), A102 (≠ V103), G148 (= G150), R151 (≠ A153), I152 (≠ V154), Y170 (≠ H172), D171 (= D173), P172 (= P174), I173 (≠ H175), H202 (= H204), T203 (≠ L205), P204 (= P206), T209 (= T211), C230 (≠ T232), A231 (= A233), R232 (≠ H234), H279 (= H284), G281 (≠ A286)
Sites not aligning to the query:
- binding (1beta,6beta,7beta,8alpha,9beta,10alpha,13alpha,14R,16beta)-1,6,7,14-tetrahydroxy-7,20-epoxykauran-15-one: 14, 17, 18, 293
6rj3A Crystal structure of phgdh in complex with compound 15 (see paper)
34% identity, 80% coverage: 45:296/316 of query aligns to 42:289/297 of 6rj3A
O43175 D-3-phosphoglycerate dehydrogenase; 3-PGDH; 2-oxoglutarate reductase; Malate dehydrogenase; EC 1.1.1.95; EC 1.1.1.399; EC 1.1.1.37 from Homo sapiens (Human) (see 3 papers)
34% identity, 79% coverage: 45:295/316 of query aligns to 48:294/533 of O43175
- T78 (= T75) binding
- R135 (= R132) to W: in PHGDHD; results in a 2-fold decrease in enzyme activity with 3-phosphohydroxypyruvate, but no change in substrate affinity; dbSNP:rs267606949
- RI 155:156 (≠ AV 153:154) binding
- D175 (= D173) binding
- T207 (≠ L205) binding
- CAR 234:236 (≠ TAH 232:234) binding
- D260 (= D258) binding
- V261 (= V259) to M: in PHGDHD; results in a four-fold decrease in substrate affinity and a slight increase in maximal enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs267606947
- HLGA 283:286 (≠ HVAG 284:287) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylalanine
- 373 A → T: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs201553627
- 377 G → S: in PHGDHD; results in a 2-fold decrease in enzyme activity with 3-phosphohydroxypyruvate, but no change in substrate affinity; dbSNP:rs267606948
- 425 V → M: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs121907988
- 490 V → M: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs121907987
2eklA Structure of st1218 protein from sulfolobus tokodaii
30% identity, 97% coverage: 4:308/316 of query aligns to 6:306/312 of 2eklA
- active site: S100 (≠ N99), R232 (≠ H234), D256 (= D258), E261 (= E263), H282 (= H284)
- binding nicotinamide-adenine-dinucleotide: I76 (≠ T75), S100 (≠ N99), G148 (= G150), G150 (= G152), R151 (≠ A153), I152 (≠ V154), Y170 (≠ H172), D171 (= D173), I172 (≠ P174), L173 (≠ H175), H202 (= H204), V203 (≠ L205), T204 (≠ P206), I212 (≠ R214), T230 (= T232), S231 (≠ A233), D256 (= D258), G284 (≠ A286)
5aovA Ternary crystal structure of pyrococcus furiosus glyoxylate hydroxypyruvate reductase in presence of glyoxylate (see paper)
31% identity, 85% coverage: 35:304/316 of query aligns to 36:308/334 of 5aovA
- active site: L100 (≠ N99), R241 (≠ H234), D265 (= D258), E270 (= E263), H288 (= H284)
- binding glyoxylic acid: M52 (≠ R51), L53 (≠ N52), L53 (≠ N52), Y74 (≠ L73), A75 (≠ G74), V76 (≠ T75), G77 (= G76), R241 (≠ H234), H288 (= H284)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V76 (≠ T75), T104 (≠ V103), F158 (≠ C151), G159 (= G152), R160 (≠ A153), I161 (≠ V154), S180 (vs. gap), R181 (vs. gap), A211 (≠ H204), V212 (≠ L205), P213 (= P206), T218 (= T211), I239 (≠ T232), A240 (= A233), R241 (≠ H234), H288 (= H284), G290 (≠ A286)
Query Sequence
>3607592 FitnessBrowser__Dino:3607592
MPHQVVITETIDTRALSRFGPEVDVIYAPELVEDRAACLVAVARADGVIVRNRTQVDRPF
LDAASRLRVIGLLGTGLDNIDMAACAARGISVHPATGANTRSVAEYVITAALMLTRRAFM
STPEMQEGAWPRGPLGEGGEIAGRKLGLYGCGAVAQAVARLAKPLSMTILGHDPHLGPGH
PLWTEVTRVSDAELLARADVLSLHLPLTPETRGRIDATALTAMKPGAILINTAHGEIVDA
RAVCDALRRGHLGGAALDVFEPEPLGTQDAARFRGVPNLILTPHVAGVTVEADRRVSALT
VDNVRAALLAPEKAVS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory