Comparing 3607593 FitnessBrowser__Dino:3607593 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4iyoB Crystal structure of cystathionine gamma lyase from xanthomonas oryzae pv. Oryzae (xometc) in complex with e-site serine, a-site serine, a- site external aldimine structure with aminoacrylate and a-site iminopropionate intermediates (see paper)
46% identity, 97% coverage: 11:379/380 of query aligns to 6:380/381 of 4iyoB
4iy7B Crystal structure of cystathionine gamma lyase (xometc) from xanthomonas oryzae pv. Oryzae in complex with e-site serine, a-site external aldimine structure with serine and a-site external aldimine structure with aminoacrylate intermediates (see paper)
46% identity, 97% coverage: 11:379/380 of query aligns to 6:380/381 of 4iy7B
4iy7A Crystal structure of cystathionine gamma lyase (xometc) from xanthomonas oryzae pv. Oryzae in complex with e-site serine, a-site external aldimine structure with serine and a-site external aldimine structure with aminoacrylate intermediates (see paper)
46% identity, 97% coverage: 11:379/380 of query aligns to 6:380/381 of 4iy7A
4ixzA Native structure of cystathionine gamma lyase (xometc) from xanthomonas oryzae pv. Oryzae at ph 9.0 (see paper)
46% identity, 97% coverage: 11:379/380 of query aligns to 6:380/381 of 4ixzA
4iyoD Crystal structure of cystathionine gamma lyase from xanthomonas oryzae pv. Oryzae (xometc) in complex with e-site serine, a-site serine, a- site external aldimine structure with aminoacrylate and a-site iminopropionate intermediates (see paper)
46% identity, 97% coverage: 11:379/380 of query aligns to 6:380/384 of 4iyoD
4ixsB Native structure of xometc at ph 5.2 (see paper)
46% identity, 97% coverage: 11:379/380 of query aligns to 5:371/372 of 4ixsB
6k1lB E53a mutant of a putative cystathionine gamma-lyase (see paper)
44% identity, 97% coverage: 11:379/380 of query aligns to 7:381/382 of 6k1lB
6k1lA E53a mutant of a putative cystathionine gamma-lyase (see paper)
44% identity, 97% coverage: 11:379/380 of query aligns to 7:381/382 of 6k1lA
7ba4A Structure of cystathionine gamma-lyase from pseudomonas aeruginosa
40% identity, 97% coverage: 11:379/380 of query aligns to 9:371/377 of 7ba4A
4l0oH Structure determination of cystathionine gamma-synthase from helicobacter pylori
41% identity, 96% coverage: 15:379/380 of query aligns to 9:370/373 of 4l0oH
8j6nA Crystal structure of cystathionine gamma-lyase in complex with compound 1 (see paper)
39% identity, 98% coverage: 8:379/380 of query aligns to 8:385/390 of 8j6nA
7mcyH Crystal structure of staphylococcus aureus cystathionine gamma lyase, holoenzyme with bound nl3 (see paper)
37% identity, 96% coverage: 15:379/380 of query aligns to 9:377/380 of 7mcyH
Sites not aligning to the query:
7mcuH Crystal structure of staphylococcus aureus cystathionine gamma lyase, holoenzyme with bound nl2 (see paper)
37% identity, 96% coverage: 15:379/380 of query aligns to 9:377/380 of 7mcuH
Sites not aligning to the query:
7mctH Crystal structure of staphylococcus aureus cystathionine gamma lyase, holoenzyme with bound nl1 (see paper)
37% identity, 96% coverage: 15:379/380 of query aligns to 9:377/380 of 7mctH
Sites not aligning to the query:
7mcqA Crystal structure of staphylococcus aureus cystathionine gamma lyase, aoaa-bound enzyme in dimeric form (see paper)
37% identity, 96% coverage: 15:379/380 of query aligns to 9:377/380 of 7mcqA
7mcbH Crystal structure of staphylococcus aureus cystathionine gamma lyase holoenzyme (see paper)
37% identity, 96% coverage: 15:379/380 of query aligns to 9:377/380 of 7mcbH
Sites not aligning to the query:
P00935 Cystathionine gamma-synthase; CGS; O-succinylhomoserine (thiol)-lyase; EC 2.5.1.48 from Escherichia coli (strain K12) (see paper)
40% identity, 97% coverage: 11:379/380 of query aligns to 7:380/386 of P00935
1cs1D Cystathionine gamma-synthase (cgs) from escherichia coli (see paper)
40% identity, 97% coverage: 11:379/380 of query aligns to 5:378/384 of 1cs1D
6cjaA Crystal structure of cystathionine beta-lyase from legionella pneumophila philadelphia 1 in complex with alanyl-plp and serine
38% identity, 99% coverage: 6:380/380 of query aligns to 1:381/381 of 6cjaA
P55217 Cystathionine gamma-synthase 1, chloroplastic; AtCGS1; METHIONINE OVERACCUMULATION 1; O-succinylhomoserine (thiol)-lyase; EC 2.5.1.48 from Arabidopsis thaliana (Mouse-ear cress) (see 4 papers)
38% identity, 86% coverage: 52:379/380 of query aligns to 226:560/563 of P55217
Sites not aligning to the query:
>3607593 FitnessBrowser__Dino:3607593
MRNLSRLHPDTLAAHGGGAVDTASGGVVPPIQPATTFRRGPDYAPLNPDNIYSRDDSEAL
RAVETLLAALEGGAGALAFPSGMAATAAVFRTLPAGARVVLQSGIYWGTTKWVRDFCARR
GVTLVEVDAADAHALGSACAAPTALVFVETPSNPWLKTVDIRAAAAAAHGAGALLVVDST
AATPVLTRPLGLGADLVMHSATKGLNGHSDVLAGALVTADAGHETWARIATDRHDAGAVL
GPFEAWLLLRGMRTLPLRVARMSATALELAQRLSTDTRVADVFYPGLPGHAGHDIAVAQM
TGGFGGLMSFLVHGDRQTALEVVGRLELFQRATSLGGVESLVEHRATIEPDSGIPETLVR
LSVGIEDAGDLWADLDRALG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory