SitesBLAST
Comparing 3607613 FitnessBrowser__Dino:3607613 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q9R4E4 3-phosphoshikimate 1-carboxyvinyltransferase; 5-enolpyruvylshikimate-3-phosphate synthase; EPSP synthase; EPSPS; EC 2.5.1.19 from Agrobacterium sp. (strain CP4) (see 2 papers)
54% identity, 100% coverage: 1:450/450 of query aligns to 1:452/455 of Q9R4E4
- KS 28:29 (= KS 28:29) binding
- R33 (= R33) binding
- NAAT 98:101 (≠ NSGT 99:102) Phosphoenolpyruvate
- A100 (≠ G101) mutation to G: Confers resistance to glyphosate.
- R128 (= R129) binding
- K353 (= K354) binding
- R357 (= R358) binding
- R405 (= R403) binding
2pqcA Cp4 epsps liganded with (r)-phosphonate tetrahedral reaction intermediate analog (see paper)
55% identity, 97% coverage: 9:445/450 of query aligns to 4:442/445 of 2pqcA
- active site: K23 (= K28), S24 (= S29), D50 (= D55), N93 (= N99), R123 (= R129), D321 (= D327), E349 (= E355), H399 (= H402), R400 (= R403), T426 (= T429)
- binding [3r-[3a,4a,5b(r*)]]-5-(1-carboxy-1-phosphonoethoxy)-4-hydroxy-3-(phosphonooxy)-1-cyclohexene-1-carboxylic acid: K23 (= K28), S24 (= S29), R28 (= R33), T96 (= T102), R123 (= R129), S168 (= S174), Q170 (= Q176), D321 (= D327), K348 (= K354), E349 (= E355), R352 (= R358), R400 (= R403)
2pqbA Cp4 epsps liganded with (r)-difluoromethyl tetrahedral intermediate analog (see paper)
55% identity, 97% coverage: 9:445/450 of query aligns to 4:442/445 of 2pqbA
- active site: K23 (= K28), S24 (= S29), D50 (= D55), N93 (= N99), R123 (= R129), D321 (= D327), E349 (= E355), H399 (= H402), R400 (= R403), T426 (= T429)
- binding (3r,4s,5r)-5-[(1r)-1-carboxy-2,2-difluoro-1-(phosphonooxy)ethoxy]-4-hydroxy-3-(phosphonooxy)cyclohex-1-ene-1-carboxylic acid: K23 (= K28), S24 (= S29), R28 (= R33), A95 (≠ G101), T96 (= T102), R123 (= R129), S168 (= S174), Q170 (= Q176), D321 (= D327), K348 (= K354), E349 (= E355), R352 (= R358), R400 (= R403)
2ggaA Cp4 epsp synthase liganded with s3p and glyphosate (see paper)
55% identity, 97% coverage: 9:445/450 of query aligns to 4:442/445 of 2ggaA
- active site: K23 (= K28), S24 (= S29), D50 (= D55), N93 (= N99), R123 (= R129), D321 (= D327), E349 (= E355), H399 (= H402), R400 (= R403), T426 (= T429)
- binding glyphosate: K23 (= K28), A94 (≠ S100), A95 (≠ G101), T96 (= T102), R123 (= R129), D321 (= D327), E349 (= E355), R352 (= R358), R400 (= R403)
- binding shikimate-3-phosphate: S24 (= S29), R28 (= R33), S168 (= S174), A169 (= A175), Q170 (= Q176), R195 (= R201), D321 (= D327), K348 (= K354)
2gg6A Cp4 epsp synthase liganded with s3p (see paper)
55% identity, 97% coverage: 9:445/450 of query aligns to 4:442/445 of 2gg6A
- active site: K23 (= K28), S24 (= S29), D50 (= D55), N93 (= N99), R123 (= R129), D321 (= D327), E349 (= E355), H399 (= H402), R400 (= R403), T426 (= T429)
- binding shikimate-3-phosphate: S24 (= S29), R28 (= R33), T96 (= T102), S168 (= S174), Q170 (= Q176), D321 (= D327), K348 (= K354)
3slhD 1.70 angstrom resolution structure of 3-phosphoshikimate 1- carboxyvinyltransferase (aroa) from coxiella burnetii in complex with shikimate-3-phosphate and glyphosate
41% identity, 96% coverage: 14:445/450 of query aligns to 9:431/440 of 3slhD
- active site: K23 (= K28), S24 (= S29), D50 (= D55), N95 (= N99), R125 (= R129), D317 (= D327), E345 (= E355), H388 (= H402), R389 (= R403), T415 (= T429)
- binding glyphosate: K23 (= K28), G97 (= G101), T98 (= T102), R125 (= R129), Q171 (= Q176), D317 (= D327), E345 (= E355), R348 (= R358), H388 (= H402), R389 (= R403)
- binding shikimate-3-phosphate: S24 (= S29), R28 (= R33), S169 (= S174), Q171 (= Q176), R196 (= R201), D317 (= D327), K344 (= K354)
- binding (3r,4s,5r)-3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid: S24 (= S29), R28 (= R33), T98 (= T102), Q171 (= Q176), R196 (= R201), D317 (= D327), K344 (= K354)
Q83E11 3-phosphoshikimate 1-carboxyvinyltransferase; 5-enolpyruvylshikimate-3-phosphate synthase; EPSP synthase; EPSPS; EC 2.5.1.19 from Coxiella burnetii (strain RSA 493 / Nine Mile phase I)
41% identity, 96% coverage: 14:445/450 of query aligns to 7:429/438 of Q83E11
- KS 21:22 (= KS 28:29) binding
- R26 (= R33) binding
- NSGT 93:96 (= NSGT 99:102) Phosphoenolpyruvate
- R123 (= R129) binding
- D315 (= D327) active site, Proton acceptor
- K342 (= K354) binding
- R346 (= R358) binding
- R387 (= R403) binding
4egrA 2.50 angstrom resolution structure of 3-phosphoshikimate 1- carboxyvinyltransferase (aroa) from coxiella burnetii in complex with phosphoenolpyruvate
41% identity, 96% coverage: 14:445/450 of query aligns to 9:427/434 of 4egrA
- active site: K23 (= K28), S24 (= S29), D50 (= D55), N95 (= N99), R125 (= R129), D313 (= D327), E341 (= E355), H384 (= H402), R385 (= R403), T411 (= T429)
- binding phosphoenolpyruvate: K23 (= K28), G97 (= G101), T98 (= T102), R125 (= R129), D313 (= D327), E341 (= E355), R344 (= R358), R385 (= R403)
Q9S400 3-phosphoshikimate 1-carboxyvinyltransferase; 5-enolpyruvylshikimate-3-phosphate synthase; EPSP synthase; EPSPS; EC 2.5.1.19 from Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) (see paper)
40% identity, 93% coverage: 18:434/450 of query aligns to 10:417/427 of Q9S400
1rf6A Structural studies of streptococcus pneumoniae epsp synthase in s3p- glp bound state (see paper)
40% identity, 93% coverage: 18:434/450 of query aligns to 10:417/427 of 1rf6A
- active site: K20 (= K28), S21 (= S29), D47 (= D55), N90 (= N99), D115 (≠ A124), R120 (= R129), D312 (= D327), E340 (= E355), H384 (= H402), R385 (= R403), T412 (= T429)
- binding glyphosate: K20 (= K28), G92 (= G101), T93 (= T102), R120 (= R129), Q168 (= Q176), D312 (= D327), E340 (= E355), R343 (= R358), H384 (= H402), R385 (= R403)
- binding shikimate-3-phosphate: S21 (= S29), R25 (= R33), S166 (= S174), Q168 (= Q176), R193 (= R201), I311 (= I326), D312 (= D327), K339 (= K354)
1rf4A Structural studies of streptococcus pneumoniae epsp synthase, tetrahedral intermediate bound state (see paper)
40% identity, 93% coverage: 18:434/450 of query aligns to 10:417/427 of 1rf4A
- active site: K20 (= K28), S21 (= S29), D47 (= D55), N90 (= N99), D115 (≠ A124), R120 (= R129), D312 (= D327), E340 (= E355), H384 (= H402), R385 (= R403), T412 (= T429)
- binding (3r,4s,5r)-5-{[(1r)-1-carboxy-2-fluoro-1-(phosphonooxy)ethyl]oxy}-4-hydroxy-3-(phosphonooxy)cyclohex-1-ene-1-carboxylic acid: K20 (= K28), S21 (= S29), R25 (= R33), G92 (= G101), T93 (= T102), R120 (= R129), S166 (= S174), A167 (= A175), Q168 (= Q176), R193 (= R201), D312 (= D327), K339 (= K354), E340 (= E355), R343 (= R358), H384 (= H402), R385 (= R403)
2pq9A E. Coli epsps liganded with (r)-difluoromethyl tetrahedral reaction intermediate analog (see paper)
30% identity, 95% coverage: 10:437/450 of query aligns to 4:420/427 of 2pq9A
- active site: K22 (= K28), S23 (= S29), D49 (= D55), N94 (= N99), P119 (≠ A124), R124 (= R129), D313 (= D327), E341 (= E355), H385 (= H402), R386 (= R403), K411 (≠ T429)
- binding (3r,4s,5r)-5-[(1r)-1-carboxy-2,2-difluoro-1-(phosphonooxy)ethoxy]-4-hydroxy-3-(phosphonooxy)cyclohex-1-ene-1-carboxylic acid: K22 (= K28), S23 (= S29), R27 (= R33), G96 (= G101), T97 (= T102), R124 (= R129), S169 (= S174), S170 (≠ A175), Q171 (= Q176), S197 (≠ A197), Y200 (≠ T200), D313 (= D327), N336 (≠ E350), K340 (= K354), R344 (= R358), H385 (= H402), R386 (= R403), K411 (≠ T429)
2aa9A Epsp synthase liganded with shikimate (see paper)
30% identity, 95% coverage: 10:437/450 of query aligns to 4:420/427 of 2aa9A
- active site: K22 (= K28), S23 (= S29), D49 (= D55), N94 (= N99), P119 (≠ A124), R124 (= R129), D313 (= D327), E341 (= E355), H385 (= H402), R386 (= R403), K411 (≠ T429)
- binding (3r,4s,5r)-3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid: K22 (= K28), S23 (= S29), R27 (= R33), T97 (= T102), Q171 (= Q176), Y200 (≠ T200), D313 (= D327), K340 (= K354)
1x8tA Epsps liganded with the (r)-phosphonate analog of the tetrahedral reaction intermediate (see paper)
30% identity, 95% coverage: 10:437/450 of query aligns to 4:420/427 of 1x8tA
- active site: K22 (= K28), S23 (= S29), D49 (= D55), N94 (= N99), P119 (≠ A124), R124 (= R129), D313 (= D327), E341 (= E355), H385 (= H402), R386 (= R403), K411 (≠ T429)
- binding [3r-[3a,4a,5b(r*)]]-5-(1-carboxy-1-phosphonoethoxy)-4-hydroxy-3-(phosphonooxy)-1-cyclohexene-1-carboxylic acid: K22 (= K28), S23 (= S29), R27 (= R33), T97 (= T102), S169 (= S174), S170 (≠ A175), Q171 (= Q176), S197 (≠ A197), Y200 (≠ T200), D313 (= D327), N336 (≠ E350), K340 (= K354), R344 (= R358), H385 (= H402), R386 (= R403)
1x8rA Epsps liganded with the (s)-phosphonate analog of the tetrahedral reaction intermediate (see paper)
30% identity, 95% coverage: 10:437/450 of query aligns to 4:420/427 of 1x8rA
- active site: K22 (= K28), S23 (= S29), D49 (= D55), N94 (= N99), P119 (≠ A124), R124 (= R129), D313 (= D327), E341 (= E355), H385 (= H402), R386 (= R403), K411 (≠ T429)
- binding [3r-[3a,4a,5b(s*)]]-5-(1-carboxy-1-phosphonoethoxy)-4-hydroxy-3-(phosphonooxy)-1-cyclohexene-1-carboxylic acid: K22 (= K28), S23 (= S29), R27 (= R33), G96 (= G101), T97 (= T102), R124 (= R129), S169 (= S174), S170 (≠ A175), Q171 (= Q176), S197 (≠ A197), Y200 (≠ T200), D313 (= D327), N336 (≠ E350), K340 (= K354), E341 (= E355), H385 (= H402), K411 (≠ T429)
1g6tA Structure of epsp synthase liganded with shikimate-3-phosphate (see paper)
30% identity, 95% coverage: 10:437/450 of query aligns to 4:420/427 of 1g6tA
- active site: K22 (= K28), S23 (= S29), D49 (= D55), N94 (= N99), P119 (≠ A124), R124 (= R129), D313 (= D327), E341 (= E355), H385 (= H402), R386 (= R403), K411 (≠ T429)
- binding phosphate ion: K22 (= K28), G96 (= G101), T97 (= T102), R124 (= R129), Q171 (= Q176), E341 (= E355), K411 (≠ T429)
- binding shikimate-3-phosphate: K22 (= K28), S23 (= S29), R27 (= R33), T97 (= T102), S169 (= S174), S170 (≠ A175), Q171 (= Q176), S197 (≠ A197), Y200 (≠ T200), D313 (= D327), N336 (≠ E350), K340 (= K354)
1g6sA Structure of epsp synthase liganded with shikimate-3-phosphate and glyphosate (see paper)
30% identity, 95% coverage: 10:437/450 of query aligns to 4:420/427 of 1g6sA
- active site: K22 (= K28), S23 (= S29), D49 (= D55), N94 (= N99), P119 (≠ A124), R124 (= R129), D313 (= D327), E341 (= E355), H385 (= H402), R386 (= R403), K411 (≠ T429)
- binding glyphosate: K22 (= K28), G96 (= G101), R124 (= R129), Q171 (= Q176), D313 (= D327), E341 (= E355), R344 (= R358), H385 (= H402), R386 (= R403)
- binding shikimate-3-phosphate: K22 (= K28), S23 (= S29), R27 (= R33), T97 (= T102), S169 (= S174), S170 (≠ A175), Q171 (= Q176), S197 (≠ A197), Y200 (≠ T200), D313 (= D327), N336 (≠ E350), K340 (= K354)
P0A6D3 3-phosphoshikimate 1-carboxyvinyltransferase; 5-enolpyruvylshikimate-3-phosphate synthase; EPSP synthase; EPSPS; EC 2.5.1.19 from Escherichia coli (strain K12) (see 8 papers)
30% identity, 95% coverage: 10:437/450 of query aligns to 4:420/427 of P0A6D3
- KS 22:23 (= KS 28:29) binding
- R27 (= R33) binding
- NAGT 94:97 (≠ NSGT 99:102) Phosphoenolpyruvate
- G96 (= G101) mutation to A: Insensitive to glyphosate with unaltered affinity for its first substrate S3P, but displays a 30-fold lower affinity for its second substrate PEP.
- T97 (= T102) mutation to I: This mutant is sensitive to glyphosate and causes a substantial decrease in the affinity for PEP. Insensitive to glyphosate but maintains high affinity for PEP. It causes a shift of residue G96 toward the glyphosate binding site, impairing efficient binding of glyphosate, while the side chain of I97 points away from the substrate binding site, facilitating PEP utilization; when associated with S-101.
- P101 (≠ L106) mutation to A: Displays a slight decrease of the affinity binding for both S3P and PEP. Decreases the binding affinity of glyphosate, reducing the potency of this inhibitor.; mutation to G: Displays a slight decrease of the affinity binding for both S3P and PEP. Decreases the binding affinity of glyphosate, reducing the potency of this inhibitor.; mutation to L: Displays a 2-fold lower affinity binding for both S3P and PEP. Decreases the binding affinity of glyphosate, reducing the potency of this inhibitor.; mutation to S: Displays a slight decrease of the affinity binding for both S3P and PEP. Decreases the binding affinity of glyphosate, reducing the potency of this inhibitor. Insensitive to glyphosate but maintains high affinity for PEP. It causes a shift of residue G96 toward the glyphosate binding site, impairing efficient binding of glyphosate, while the side chain of I97 points away from the substrate-binding site, facilitating PEP utilization; when associated with I-97.
- R124 (= R129) binding
- SSQ 169:171 (≠ SAQ 174:176) binding
- S197 (≠ A197) binding
- D313 (= D327) active site, Proton acceptor; mutation to A: The enolpyruvyl transfer reaction is halted after formation of the tetrahedral adduct of the substrates.
- N336 (≠ E350) binding
- K340 (= K354) binding
- E341 (= E355) active site, Proton donor
- R344 (= R358) binding
- R386 (= R403) binding
- C408 (≠ P426) Modified by bromopyruvate
- K411 (≠ T429) Modified by bromopyruvate; binding
3fjzA E. Coli epsp synthase (t97i) liganded with s3p and glyphosate (see paper)
29% identity, 95% coverage: 10:437/450 of query aligns to 4:420/427 of 3fjzA
- active site: K22 (= K28), S23 (= S29), D49 (= D55), N94 (= N99), P119 (≠ A124), R124 (= R129), D313 (= D327), E341 (= E355), H385 (= H402), R386 (= R403), K411 (≠ T429)
- binding N-(phosphonomethyl)glycine: K22 (= K28), G96 (= G101), R124 (= R129), Q171 (= Q176), D313 (= D327), E341 (= E355), R344 (= R358), H385 (= H402), R386 (= R403)
- binding shikimate-3-phosphate: K22 (= K28), S23 (= S29), R27 (= R33), I97 (≠ T102), S169 (= S174), S170 (≠ A175), Q171 (= Q176), S197 (≠ A197), Y200 (≠ T200), D313 (= D327), N336 (≠ E350), K340 (= K354)
- binding serine: I265 (= I268), G266 (= G269), S269 (≠ P272)
1q36A Epsp synthase (asp313ala) liganded with tetrahedral reaction intermediate (see paper)
29% identity, 95% coverage: 10:437/450 of query aligns to 4:420/427 of 1q36A
- active site: K22 (= K28), S23 (= S29), D49 (= D55), N94 (= N99), P119 (≠ A124), R124 (= R129), A313 (≠ S324), E341 (= E355), H385 (= H402), R386 (= R403), K411 (≠ T429)
- binding 5-(1-carboxy-1-phosphonooxy-ethoxyl)-4-hydroxy-3-phosphonooxy-cyclohex-1-enecarboxylic acid: K22 (= K28), S23 (= S29), R27 (= R33), G96 (= G101), T97 (= T102), R124 (= R129), S169 (= S174), S170 (≠ A175), Q171 (= Q176), S197 (≠ A197), Y200 (≠ T200), N336 (≠ E350), K340 (= K354), E341 (= E355), R344 (= R358), R386 (= R403), K411 (≠ T429)
Query Sequence
>3607613 FitnessBrowser__Dino:3607613
MSAHGDPIPMTAHPSGPLSGTAQVPGDKSISHRSLILGALAVGETKVTGLLEGQDVLDTA
RAMQAFGAEVIQHAPGAWSVHGVGTGGFAEPEDVIDCGNSGTGVRLIMGAMATTPITATF
TGDASLRSRPMGRITDPLAGFGTTAVGRRGGRLPMTLTGAADPVPVRYTVPVPSAQVKSA
VLLAGLNAPGQTVVIEAEATRDHSERMLRGFGAEISVESAPEGNVITLTGQPELRPQTIV
VPRDPSSAAFPVAVGLIVPGSDVLVPGIGLNPTRAGLYTTLQEMGAELSFENMREEGGEP
VADLRARFSDAMQGIEVPPERAPSMIDEYPILSVIAAYATGRTVMRGVKELRVKESDRID
AMARGLEACGVRVEEDEDTLIVHGMGPGGVPGGATCASHLDHRIAMSFLCCGLAAQTPVS
VDDGGPIATSFPIFEPLMTALGATLTRDST
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory